SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1vfcA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vfcA
Domain Number 1 Region: 11-61
Classification Level Classification E-value
Superfamily Homeodomain-like 9.4e-16
Family DNA-binding domain of telomeric protein 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1vfcA   PDB: 1vfc
Sequence length 63
Comment (A:)
Sequence
edsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrtmkrl
gmn
Download sequence
Identical sequences cath|current|1vfcA00/438-500 d1vfca1 d1xg1a1 1vfcA 1vfc_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]