SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1vhvA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vhvA
Domain Number 1 Region: 15-259
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 3.44e-50
Family Tetrapyrrole methylase 0.000000000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1vhvA   PDB: 1vhv   SUPERFAMILY: 1vhvA
Sequence length 268
Comment (A:)
Sequence
mghhhhhhgghmslltfvglglwdvkdisvkgleavreadevyveyytskllssieemee
ffgkrvvelersdleensfrlieraksksvvllvpgdpmvatthsaikleaerkgvktri
ihgasistavcgltglhnyrfgksatvswhrsqtpvnvikanrsidahtllfldlhpepm
tighavenliaedaqmkdlyavgiaragsgeevvkcdrlenlkkidfgkplhvmvvlakt
lhfmefeclrefadapaelerlvaeggs
Download sequence
Identical sequences 1vhvA 1vhv_A 1vhv_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]