SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1vl2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vl2A
Domain Number 1 Region: 183-412
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 1.46e-146
Family Argininosuccinate synthetase, C-terminal domain 0.0000013
Further Details:      
 
Domain Number 2 Region: 14-181
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.05e-68
Family N-type ATP pyrophosphatases 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1vl2A   PDB: 1vl2
Sequence length 421
Comment (A:)
Sequence
mgsdkihhhhhhmkekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikek
alktgaskvyvedlrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekeg
aqyvahgatgkgndqvrfeltyaalnpnlkvispwkdpeflakfkgrtdlinyamekgip
ikvskkrpysedenlmhisheagkledpahipdedvftwtvspkdapdeetlleihfeng
ipvkvvnlkdgtektdplelfeylnevgakngvgrldmvenrfigiksrgvyetpgatil
wiahrdlegitmdkevmhlrdmlapkfaeliyngfwfspemefllaafrkaqenvtgkvt
vsiykgnvmpvaryspyslynpelssmdveggfdatdskgfinihalrlkvhqlvkkgyq
r
Download sequence
Identical sequences 1vl2_A 1vl2_B 1vl2_C 1vl2_D 1vl2A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]