SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1vlfN from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vlfN
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.09e-44
Family Ferredoxin domains from multidomain proteins 0.00000000333
Further Details:      
 
Domain Number 2 Region: 206-269
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00000000154
Family Cna protein B-type domain 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1vlfN   PDB: 1vlf
Sequence length 274
Comment (N:)
Sequence
MEQYYMVIDVAKCQDCNNCFMGCMDEHELNEWPGYTASMQRGHRWMNIERRERGTYPRND
INYRPTPCMHCENAPCVAKGNGAVYQREDGIVLIDPEKAKGKKELLDTCPYGVMYWNEEE
NVAQKCTMCAHLLDDESWAPKMPRCAHNCGSFVYEFLKTTPEAMAKKVEEEGLEVIKPEL
GTKPRVYYKNLYRFEKNYVTAGILVQGDCFEGAKVVLKSGGKEVASAETNFFGEFKFDAL
DNGEYTVEIDADGKSYSDTVVIDDKSVDLGFIKL
Download sequence
Identical sequences P80564
1vlfN 4v4c_B 4v4c_D 4v4c_F 4v4c_H 4v4c_J 4v4c_L 4v4c_N 4v4c_P 4v4c_R 4v4c_T 4v4c_V 4v4c_X 4v4d_B 4v4d_D 4v4d_F 4v4d_H 4v4d_J 4v4d_L 4v4d_N 4v4d_P 4v4d_R 4v4d_T 4v4d_V 4v4d_X 4v4e_B 4v4e_D 4v4e_F 4v4e_H 4v4e_J 4v4e_L 4v4e_N 4v4e_P 4v4e_R 4v4e_T 4v4e_V 4v4e_X

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]