SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1vllA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vllA
Domain Number 1 Region: 13-332
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.11e-107
Family Ornithine cyclodeaminase-like 0.0000000000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1vllA   PDB: 1vll   SUPERFAMILY: 1vllA
Sequence length 334
Comment (A:)
Sequence
mgsdkihhhhhhmetliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefek
gdlrampahlmgyaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslr
tgaaggiaakylarknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvs
ycedrgisasvqpaeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldv
eilkkakivvddleqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitif
dstglaiqdvavakvvyenalsknvgskikffri
Download sequence
Identical sequences 1vllA 1vll_A 1vll_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]