SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1vr4A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vr4A
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily YbjQ-like 1.02e-36
Family YbjQ-like 0.00000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1vr4A   PDB: 1vr4
Sequence length 103
Comment (A:)
Sequence
MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDI
AMDEMKELAKQKGANAIVGVDVDYEVVRDGMLMVAVSGTAVRI
Download sequence
Identical sequences A0A0B5NKW1 A0A0B5XS01 A0A0D1P9T9 A0A0E1MQH1 A0A0F5RHG4 A0A0G4D665 A0A0K6N046 A0A0T8XE34 A0A125U534 A0A154B1L4 A0A1C9BPC5 A0A1J9T0T8 A0A1J9U125 A0A1J9ZZA9 A0A1M6GR58 A0A1Q9KMD4 A0A229M2Z7 A0A229MA53 A0A242WDE7 A0A243BH43 A0A243BXR0 A0A243C813 A0A243D7B1 A0A243DM04 A0A243FC47 A0A243HHS6 A0A243HVL8 A0A243IJ93 A0A243JB60 A0A243K7J5 A0A243LD58 A0A243NJ30 A0A246UGJ2 A0A2A2PBQ6 A0A2A7X419 A0A2A9HZ20 A0A2B4ECX1 A0A2C9YIN1 A0A2C9YR70 A0A2K1RXV7 B3Z2R2 B3ZLZ1 B7HFY0 B7HYR6 B7JCT0 B9ISE5 C2MH38 C2NDY4 C2Q899 C2QPA8 C2R4F8 C2S004 C2SX90 C2TCR3 C2UA82 C2VPY1 C2WIU0 C3BYN0 C3DZW0 C3FZB4 C3GF45 C3GXD8 D8H4A1 F0PN30 J8FVV0 J8HJQ9 J8HZI0 J8JAJ1 J8KDJ7 J8KZY7 J8L8W7 J8LS44 J8MEP5 N1LWE1 Q5LKC0 Q63F05 Q6HMG1 Q81H14 Q81U83 R8GXF2 R8UBX0 S3IRZ9
gi|301052643|ref|YP_003790854.1| gi|375283084|ref|YP_005103522.1| gi|229604910|ref|YP_002865556.1| NP_830798.1.86172 NP_843502.1.87267 WP_000637511.1.100059 WP_000637511.1.100082 WP_000637511.1.100214 WP_000637511.1.100241 WP_000637511.1.100409 WP_000637511.1.10055 WP_000637511.1.100684 WP_000637511.1.10069 WP_000637511.1.100873 WP_000637511.1.100912 WP_000637511.1.101309 WP_000637511.1.101550 WP_000637511.1.101843 WP_000637511.1.101931 WP_000637511.1.10208 WP_000637511.1.10584 WP_000637511.1.10762 WP_000637511.1.11044 WP_000637511.1.11060 WP_000637511.1.11387 WP_000637511.1.11442 WP_000637511.1.11676 WP_000637511.1.1228 WP_000637511.1.12289 WP_000637511.1.12751 WP_000637511.1.13024 WP_000637511.1.13115 WP_000637511.1.13221 WP_000637511.1.13233 WP_000637511.1.13299 WP_000637511.1.13498 WP_000637511.1.1354 WP_000637511.1.13820 WP_000637511.1.14006 WP_000637511.1.14174 WP_000637511.1.14176 WP_000637511.1.14721 WP_000637511.1.14855 WP_000637511.1.14882 WP_000637511.1.15163 WP_000637511.1.15460 WP_000637511.1.15569 WP_000637511.1.16013 WP_000637511.1.16156 WP_000637511.1.16170 WP_000637511.1.16199 WP_000637511.1.16997 WP_000637511.1.17146 WP_000637511.1.17408 WP_000637511.1.17424 WP_000637511.1.17899 WP_000637511.1.17927 WP_000637511.1.1850 WP_000637511.1.18840 WP_000637511.1.18914 WP_000637511.1.18976 WP_000637511.1.19173 WP_000637511.1.19258 WP_000637511.1.19435 WP_000637511.1.19438 WP_000637511.1.19445 WP_000637511.1.195 WP_000637511.1.20208 WP_000637511.1.20390 WP_000637511.1.20651 WP_000637511.1.20680 WP_000637511.1.20687 WP_000637511.1.20865 WP_000637511.1.20973 WP_000637511.1.21021 WP_000637511.1.21055 WP_000637511.1.21172 WP_000637511.1.21258 WP_000637511.1.21643 WP_000637511.1.21776 WP_000637511.1.226 WP_000637511.1.22699 WP_000637511.1.22865 WP_000637511.1.22991 WP_000637511.1.23100 WP_000637511.1.23110 WP_000637511.1.23200 WP_000637511.1.23269 WP_000637511.1.23540 WP_000637511.1.23615 WP_000637511.1.23652 WP_000637511.1.23873 WP_000637511.1.24182 WP_000637511.1.24184 WP_000637511.1.2419 WP_000637511.1.24334 WP_000637511.1.24377 WP_000637511.1.24556 WP_000637511.1.24608 WP_000637511.1.24676 WP_000637511.1.24680 WP_000637511.1.24709 WP_000637511.1.24795 WP_000637511.1.2521 WP_000637511.1.25290 WP_000637511.1.25316 WP_000637511.1.25599 WP_000637511.1.2569 WP_000637511.1.25716 WP_000637511.1.25752 WP_000637511.1.25757 WP_000637511.1.26000 WP_000637511.1.2618 WP_000637511.1.26513 WP_000637511.1.26637 WP_000637511.1.26665 WP_000637511.1.26721 WP_000637511.1.26826 WP_000637511.1.26872 WP_000637511.1.27334 WP_000637511.1.27644 WP_000637511.1.27987 WP_000637511.1.28427 WP_000637511.1.28729 WP_000637511.1.28913 WP_000637511.1.29101 WP_000637511.1.29209 WP_000637511.1.29451 WP_000637511.1.29787 WP_000637511.1.29804 WP_000637511.1.30110 WP_000637511.1.30216 WP_000637511.1.3026 WP_000637511.1.30317 WP_000637511.1.30336 WP_000637511.1.31490 WP_000637511.1.31503 WP_000637511.1.31685 WP_000637511.1.3236 WP_000637511.1.32522 WP_000637511.1.32576 WP_000637511.1.32784 WP_000637511.1.32927 WP_000637511.1.33045 WP_000637511.1.33061 WP_000637511.1.33175 WP_000637511.1.3318 WP_000637511.1.33201 WP_000637511.1.33338 WP_000637511.1.33367 WP_000637511.1.33536 WP_000637511.1.33717 WP_000637511.1.33740 WP_000637511.1.33828 WP_000637511.1.33876 WP_000637511.1.34158 WP_000637511.1.34646 WP_000637511.1.35153 WP_000637511.1.35255 WP_000637511.1.35518 WP_000637511.1.3561 WP_000637511.1.35684 WP_000637511.1.35886 WP_000637511.1.3612 WP_000637511.1.3615 WP_000637511.1.36221 WP_000637511.1.36305 WP_000637511.1.36763 WP_000637511.1.3699 WP_000637511.1.37093 WP_000637511.1.37626 WP_000637511.1.3798 WP_000637511.1.37990 WP_000637511.1.38036 WP_000637511.1.38345 WP_000637511.1.38425 WP_000637511.1.38517 WP_000637511.1.39781 WP_000637511.1.39957 WP_000637511.1.40550 WP_000637511.1.40839 WP_000637511.1.41165 WP_000637511.1.41365 WP_000637511.1.41464 WP_000637511.1.41518 WP_000637511.1.41675 WP_000637511.1.41976 WP_000637511.1.42165 WP_000637511.1.42217 WP_000637511.1.43104 WP_000637511.1.43533 WP_000637511.1.43762 WP_000637511.1.44348 WP_000637511.1.4439 WP_000637511.1.44463 WP_000637511.1.44483 WP_000637511.1.45305 WP_000637511.1.45317 WP_000637511.1.45385 WP_000637511.1.45533 WP_000637511.1.45919 WP_000637511.1.46236 WP_000637511.1.46244 WP_000637511.1.46326 WP_000637511.1.46476 WP_000637511.1.4649 WP_000637511.1.46549 WP_000637511.1.46699 WP_000637511.1.46746 WP_000637511.1.46864 WP_000637511.1.47097 WP_000637511.1.47145 WP_000637511.1.47441 WP_000637511.1.4763 WP_000637511.1.47644 WP_000637511.1.47798 WP_000637511.1.47936 WP_000637511.1.47975 WP_000637511.1.48010 WP_000637511.1.48164 WP_000637511.1.48311 WP_000637511.1.48599 WP_000637511.1.4865 WP_000637511.1.49056 WP_000637511.1.49428 WP_000637511.1.4964 WP_000637511.1.49831 WP_000637511.1.5025 WP_000637511.1.50316 WP_000637511.1.50514 WP_000637511.1.50770 WP_000637511.1.51072 WP_000637511.1.51087 WP_000637511.1.51167 WP_000637511.1.51335 WP_000637511.1.51656 WP_000637511.1.51749 WP_000637511.1.52494 WP_000637511.1.52756 WP_000637511.1.52794 WP_000637511.1.53137 WP_000637511.1.53493 WP_000637511.1.53621 WP_000637511.1.53683 WP_000637511.1.53879 WP_000637511.1.54116 WP_000637511.1.54117 WP_000637511.1.54189 WP_000637511.1.54240 WP_000637511.1.54547 WP_000637511.1.54736 WP_000637511.1.54775 WP_000637511.1.54782 WP_000637511.1.55057 WP_000637511.1.55116 WP_000637511.1.55811 WP_000637511.1.55958 WP_000637511.1.55968 WP_000637511.1.56042 WP_000637511.1.56055 WP_000637511.1.56176 WP_000637511.1.56270 WP_000637511.1.5628 WP_000637511.1.56318 WP_000637511.1.56320 WP_000637511.1.56580 WP_000637511.1.56959 WP_000637511.1.57203 WP_000637511.1.57245 WP_000637511.1.57565 WP_000637511.1.57815 WP_000637511.1.57859 WP_000637511.1.58037 WP_000637511.1.58160 WP_000637511.1.58328 WP_000637511.1.58586 WP_000637511.1.58814 WP_000637511.1.58822 WP_000637511.1.59052 WP_000637511.1.59058 WP_000637511.1.59095 WP_000637511.1.59173 WP_000637511.1.59310 WP_000637511.1.59575 WP_000637511.1.59978 WP_000637511.1.59997 WP_000637511.1.60153 WP_000637511.1.60274 WP_000637511.1.60402 WP_000637511.1.60781 WP_000637511.1.60841 WP_000637511.1.61213 WP_000637511.1.61231 WP_000637511.1.62107 WP_000637511.1.62300 WP_000637511.1.6304 WP_000637511.1.63137 WP_000637511.1.6340 WP_000637511.1.63560 WP_000637511.1.63611 WP_000637511.1.63902 WP_000637511.1.64282 WP_000637511.1.64377 WP_000637511.1.64491 WP_000637511.1.64568 WP_000637511.1.64706 WP_000637511.1.65803 WP_000637511.1.65983 WP_000637511.1.66331 WP_000637511.1.66357 WP_000637511.1.66932 WP_000637511.1.66999 WP_000637511.1.67001 WP_000637511.1.67108 WP_000637511.1.67239 WP_000637511.1.6753 WP_000637511.1.67873 WP_000637511.1.67912 WP_000637511.1.6846 WP_000637511.1.68562 WP_000637511.1.68607 WP_000637511.1.69203 WP_000637511.1.69323 WP_000637511.1.69822 WP_000637511.1.69894 WP_000637511.1.69970 WP_000637511.1.70065 WP_000637511.1.70108 WP_000637511.1.70645 WP_000637511.1.7096 WP_000637511.1.70996 WP_000637511.1.71114 WP_000637511.1.71441 WP_000637511.1.71648 WP_000637511.1.71895 WP_000637511.1.71953 WP_000637511.1.72514 WP_000637511.1.72704 WP_000637511.1.73325 WP_000637511.1.73396 WP_000637511.1.73594 WP_000637511.1.73790 WP_000637511.1.7398 WP_000637511.1.74226 WP_000637511.1.74337 WP_000637511.1.74538 WP_000637511.1.7534 WP_000637511.1.7544 WP_000637511.1.7545 WP_000637511.1.75870 WP_000637511.1.75891 WP_000637511.1.7593 WP_000637511.1.76086 WP_000637511.1.76125 WP_000637511.1.76155 WP_000637511.1.7628 WP_000637511.1.76783 WP_000637511.1.76804 WP_000637511.1.77370 WP_000637511.1.77576 WP_000637511.1.77668 WP_000637511.1.77690 WP_000637511.1.77824 WP_000637511.1.782 WP_000637511.1.7856 WP_000637511.1.78644 WP_000637511.1.79250 WP_000637511.1.79252 WP_000637511.1.79315 WP_000637511.1.79584 WP_000637511.1.79658 WP_000637511.1.79687 WP_000637511.1.80126 WP_000637511.1.80239 WP_000637511.1.80439 WP_000637511.1.80571 WP_000637511.1.80649 WP_000637511.1.80695 WP_000637511.1.80955 WP_000637511.1.80964 WP_000637511.1.81088 WP_000637511.1.81198 WP_000637511.1.81773 WP_000637511.1.81799 WP_000637511.1.82289 WP_000637511.1.82421 WP_000637511.1.82533 WP_000637511.1.82986 WP_000637511.1.83070 WP_000637511.1.83228 WP_000637511.1.83938 WP_000637511.1.83951 WP_000637511.1.84045 WP_000637511.1.84337 WP_000637511.1.84422 WP_000637511.1.8450 WP_000637511.1.85348 WP_000637511.1.85592 WP_000637511.1.85689 WP_000637511.1.85901 WP_000637511.1.86082 WP_000637511.1.86119 WP_000637511.1.86140 WP_000637511.1.86239 WP_000637511.1.86288 WP_000637511.1.86374 WP_000637511.1.86637 WP_000637511.1.8698 WP_000637511.1.87627 WP_000637511.1.87768 WP_000637511.1.87873 WP_000637511.1.87947 WP_000637511.1.88154 WP_000637511.1.88200 WP_000637511.1.8825 WP_000637511.1.88431 WP_000637511.1.88641 WP_000637511.1.8923 WP_000637511.1.89675 WP_000637511.1.90155 WP_000637511.1.90187 WP_000637511.1.90352 WP_000637511.1.90596 WP_000637511.1.90671 WP_000637511.1.90791 WP_000637511.1.90883 WP_000637511.1.91080 WP_000637511.1.91367 WP_000637511.1.91404 WP_000637511.1.91569 WP_000637511.1.91615 WP_000637511.1.9186 WP_000637511.1.92686 WP_000637511.1.9269 WP_000637511.1.92831 WP_000637511.1.93271 WP_000637511.1.93290 WP_000637511.1.93683 WP_000637511.1.93744 WP_000637511.1.93838 WP_000637511.1.93893 WP_000637511.1.93927 WP_000637511.1.93932 WP_000637511.1.94237 WP_000637511.1.94322 WP_000637511.1.94373 WP_000637511.1.94784 WP_000637511.1.95308 WP_000637511.1.9533 WP_000637511.1.95457 WP_000637511.1.95484 WP_000637511.1.95576 WP_000637511.1.95786 WP_000637511.1.9623 WP_000637511.1.96287 WP_000637511.1.96356 WP_000637511.1.96437 WP_000637511.1.97149 WP_000637511.1.97262 WP_000637511.1.97327 WP_000637511.1.97617 WP_000637511.1.97670 WP_000637511.1.97781 WP_000637511.1.97842 WP_000637511.1.98053 WP_000637511.1.98216 WP_000637511.1.98519 WP_000637511.1.98557 WP_000637511.1.98571 WP_000637511.1.98604 WP_000637511.1.99266 WP_000637511.1.99454 WP_000637511.1.99485 WP_000637511.1.99994 YP_027210.1.16718 YP_035260.1.62562 YP_173282.1.62562 gi|386734820|ref|YP_006208001.1| gi|217958590|ref|YP_002337138.1| gi|402553488|ref|YP_006594759.1| gi|47526280|ref|YP_017629.1| gi|376264932|ref|YP_005117644.1| 1vr4A 000068194|e1vr4D1|872.3.1.2|D:1-103 000068197|e1vr4C1|872.3.1.2|C:1-103 000068198|e1vr4E1|872.3.1.2|E:1-103 000068200|e1vr4A1|872.3.1.2|A:1-103 000160535|e2gtcA1|872.3.1.2|A:1-103 000299856|e2gtcB1|872.3.1.2|B:1-103 000299857|e2gtcC1|872.3.1.2|C:1-103 000299858|e2gtcD1|872.3.1.2|D:1-103 000299859|e2gtcE1|872.3.1.2|E:1-103 cath|current|1vr4A00/1-103 cath|current|1vr4B00/1-103 cath|current|1vr4C00/1-103 cath|current|1vr4D00/1-103 cath|current|1vr4E00/1-103 cath|current|1ybbA00/1-103 cath|current|1ybbB00/1-103 cath|current|1ybbC00/1-103 cath|current|1ybbD00/1-103 cath|current|1ybbE00/1-103 d1vr4a1 d1vr4b_ d1vr4c_ d1vr4d_ d1vr4e_ d1ybba_ d1ybbc_ d1ybbd_ d1ybbe_ d2gtca_ d2gtcb_ d2gtcc_ d2gtcd_ d2gtce_ gi|56899910|ref|YP_173282.1|NC_006578 gi|227816143|ref|YP_002816152.1| 1vr4_A 1vr4_B 1vr4_C 1vr4_D 1vr4_E APC22750 BcR11 198094.BA_1001 226900.BC1012 260799.BAS0936 261594.GBAA1001 281309.BT9727_0921 281309.pBT9727_0039 288681.BCZK0904 361100.BCQ_1077 405532.BCB4264_A1042 405534.BCAH187_A1168 405535.BCAH820_1077 568206.BAMEG_3570 572264.BCA_1038 592021.BAA_1095 gi|49183958|ref|YP_027210.1| gi|222094739|ref|YP_002528799.1| gi|52144320|ref|YP_082507.1| gi|49477045|ref|YP_035260.1| gi|56899910|ref|YP_173282.1| gi|296501724|ref|YP_003663424.1| gi|218902195|ref|YP_002450029.1| gi|30019167|ref|NP_830798.1| gi|218231090|ref|YP_002365775.1| gi|225862949|ref|YP_002748327.1| gi|30261125|ref|NP_843502.1| gi|384178954|ref|YP_005564716.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]