SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1w7bA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1w7bA
Domain Number 1 Region: 25-339
Classification Level Classification E-value
Superfamily Annexin 3.88e-186
Family Annexin 0.0000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1w7bA   PDB: 1w7b   SUPERFAMILY: 1w7bA
Sequence length 339
Comment (A:)
Sequence
mstvheilcklslegdhstppsaygsvkaytnfdaerdalnietaiktkgvdevtivnil
tnrsneqrqdiafayqrrtkkelasalksalsghletvilgllktpaqydaselkasmkg
lgtdedslieiicsrtnqelqeinrvykemyktdlekdiisdtsgdfrklmvalakgrra
edgsvidyelidqdardlydagvkrkgtdvpkwisimtersvphlqkvfdryksyspydm
lesirkevkgdlenaflnlvqciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdm
lkirsefkrkygkslyyyiqqdtkgdyqkallylcggdd
Download sequence
Identical sequences 1w7b_A 1w7bA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]