SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wd8A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wd8A
Domain Number 1 Region: 301-670
Classification Level Classification E-value
Superfamily Pentein 2.82e-286
Family Peptidylarginine deiminase Pad4, catalytic C-terminal domain 0.0000000879
Further Details:      
 
Domain Number 2 Region: 120-300
Classification Level Classification E-value
Superfamily Peptidylarginine deiminase Pad4, middle domain 1.32e-101
Family Peptidylarginine deiminase Pad4, middle domain 0.000000436
Further Details:      
 
Domain Number 3 Region: 14-118
Classification Level Classification E-value
Superfamily Cupredoxins 4.16e-63
Family Peptidylarginine deiminase Pad4, N-terminal domain 0.00000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1wd8A   PDB: 1wd8
Sequence length 670
Comment (A:)
Sequence
gplgspqmaqgtlirvtpeqpthavcvlgtltqldicssapedctsfsinaspgvvvdia
hsppakkkstgsstwpldpgvevtltmkaasgstgdqkvqisyygpktppvkallyltav
eislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevld
sedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpkw
pshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfrv
apwimtpntqppqevyacsifenedflksvttlamkakcklticpeeenmddqwmqdeme
igyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpqtggisgldsfgnlevs
ppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvqapvklysdwlsvghvd
eflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfegikkkkqqkiknilsnk
tlrehnsfvercidwnrellkrelglaesdiidipqlfklkefskaeaffpnmvnmlvlg
khlgipkpfgpvingrccleekvcslleplglqctfindfftyhirhgevhcgtnvrrkp
fsfkwwnmvp
Download sequence
Identical sequences 1wd8_A 5n0m_A 5n0y_A 5n0z_A 5n1b_A 1wd8A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]