SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wgoA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wgoA
Domain Number 1 Region: 8-120
Classification Level Classification E-value
Superfamily PKD domain 1.32e-21
Family PKD domain 0.00000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1wgoA   PDB: 1wgo   SUPERFAMILY: 1wgoA
Sequence length 123
Comment (A:)
Sequence
gssgssgceggvdmqqsqvqlqcpltpprglqvsiqgeavavrpgedvlfvvrqeqgdvl
ttkyqvdlgdgfkamyvnltltgepirhryespgiyrvsvraentaghdeavlfvqvsgp
ssg
Download sequence
Identical sequences 000001774|e1wgoA1|11.1.1.147|A:1-123 1wgoA 1wgo_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]