SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wi3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wi3A
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily Homeodomain-like 2.01e-17
Family Homeodomain 0.0000652
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1wi3A   PDB: 1wi3   SUPERFAMILY: 1wi3A
Sequence length 71
Comment (A:)
Sequence
gssgssgprsrtkislealgilqsfihdvglypdqeaihtlsaqldlpkhtiikffqnqr
yhvkhsgpssg
Download sequence
Identical sequences 000045257|e1wi3A1|101.1.1.10|A:1-71 1wi3_A 1wi3A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]