SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wl8A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wl8A
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 4.14e-56
Family Class I glutamine amidotransferases (GAT) 0.00000000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1wl8A   PDB: 1wl8
Sequence length 189
Comment (A:)
Sequence
MMIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGN
CEKVLEHYDEFNVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVEIEIIDEDEIFKGLPK
RLKVWESHMDEVKELPPKFKILARSETCPIEAMKHEELPIYGVQFHPEVAHTEKGEEILR
NFAKLCGEL
Download sequence
Identical sequences O59071
gi|14591153|ref|NP_143229.1| 70601.PH1346 1wl8A pho001001346.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]