SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wn0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wn0A
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 4.1e-40
Family Phosphorelay protein-like 0.0000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1wn0A   PDB: 1wn0
Sequence length 145
Comment (A:)
Sequence
MAAAALREQLNALLSSMFASGLVDEQFQQLQMLQEDGGTPGFVAEVVTLFCDDADRIISE
LAALLDQPIVDFDKVDAYVHQLKGSSASVGAQKVKFTCMQFRQLCQDKNRDGCIMALAVV
RNEFYDLRNKFQTMLQLEQQIQAQQ
Download sequence
Identical sequences Q9SLX1
GRMZM2G014154_T04|PACid:20841761 NP_001104850.1.34533 NP_001335481.1.34533 1wn0A ar_001000983.1 1wn0_A 1wn0_B 1wn0_C 1wn0_D cath|current|1wn0A00/9-139 cath|current|1wn0B00/11-138 cath|current|1wn0C00/5-142 cath|current|1wn0D00/5-142 GRMZM2G014154_P04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]