SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wu7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wu7A
Domain Number 1 Region: 7-319
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.11e-70
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000000318
Further Details:      
 
Domain Number 2 Region: 334-423
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.49e-19
Family Anticodon-binding domain of Class II aaRS 0.0000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1wu7A   PDB: 1wu7
Sequence length 434
Comment (A:)
Sequence
myrlqiekirgfrdfypedmdvekfifktaeeaaeafgfrridfpsleyldlyriksgee
llqqtysfvdkggrevtlipeatpstvrmvtsrkdlqrplrwysfpkvwryeepqagryr
ehyqfnadifgsdspeadaevialassildrlglqdiyeirinsrkimeeiiggmtssdp
fsvfsiidryhkisreefvdqlrsagigedgvsmiadlcsgtrgidemaritgksseeia
rmaavedllasygvknvrydfsivrglsyytgivfeaydrsgqfrailgggrydnlaslm
sgesvpavgfgmgdavislllkrenvqiprekksvyicrvgkinssimneysrklrergm
nvtveimerglsaqlkyasaigadfavifgerdlergvvtirnmytgsqenvgldsvveh
lisqatlehhhhhh
Download sequence
Identical sequences 1wu7A 1wu7_A 1wu7_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]