SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wxiA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wxiA
Domain Number 1 Region: 3-273
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.31e-116
Family N-type ATP pyrophosphatases 0.000000795
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1wxiA   PDB: 1wxi
Sequence length 275
Comment (A:)
Sequence
MTLQQQIIKALGAKPQINAEEEIRRSVDFLKSYLQTYPFIKSLVLGISGGQDSTLAGKLC
QMAINELRLETGNESLQFIAVRLPYGVQADEQDCQDAIAFIQPDRVLTVNIKGAVLASEQ
ALREAGIELSDFVRGNEKARERMKAQYSIAGMTSGVVVGTDHAAEAITGFFTKYGDGGTD
INPLYRLNKRQGKQLLAALACPEHLYKKAPTADLEDDRPSLPDEVALGVTYDNIDDYLEG
KNVPQQVARTIENWYLKTEHKRRPPITVFDDFWKK
Download sequence
Identical sequences A0A069XLT6 A0A070SVL3 A0A070V366 A0A0E0U096 A0A0E1LXW7 A0A0E1T0W1 A0A0M7NSJ7 A0A1X3IM90 A0A1X3JG28 A0A236MSA0 A0A236QHW0 A8A0T1 B1IPJ0 B1XGK1 C4ZZ96 F4SKF8 G0F576 H4UJU8 I2XCW9 L2V0H7 M9G6S8 P18843 S1EK97 S1IJ43 T9DAW1 U9ZLL4 V2S6W2 W8TE29
316385.ECDH10B_1878 316407.nadE 331112.EcHS_A1822 481805.EcolC_1892 511145.b1740 595496.BWG_1553 NP_416254.1.90541 WP_000175026.1.100085 WP_000175026.1.100111 WP_000175026.1.100159 WP_000175026.1.100251 WP_000175026.1.10034 WP_000175026.1.100441 WP_000175026.1.100444 WP_000175026.1.100451 WP_000175026.1.100487 WP_000175026.1.100496 WP_000175026.1.10051 WP_000175026.1.100614 WP_000175026.1.100753 WP_000175026.1.100824 WP_000175026.1.10086 WP_000175026.1.100868 WP_000175026.1.10094 WP_000175026.1.100966 WP_000175026.1.101033 WP_000175026.1.101158 WP_000175026.1.101186 WP_000175026.1.101282 WP_000175026.1.101654 WP_000175026.1.101737 WP_000175026.1.101747 WP_000175026.1.101777 WP_000175026.1.10187 WP_000175026.1.10188 WP_000175026.1.101908 WP_000175026.1.10233 WP_000175026.1.10235 WP_000175026.1.10252 WP_000175026.1.10304 WP_000175026.1.1040 WP_000175026.1.10417 WP_000175026.1.10491 WP_000175026.1.10496 WP_000175026.1.1058 WP_000175026.1.10729 WP_000175026.1.10833 WP_000175026.1.11047 WP_000175026.1.11118 WP_000175026.1.1113 WP_000175026.1.11241 WP_000175026.1.11408 WP_000175026.1.11418 WP_000175026.1.11436 WP_000175026.1.1168 WP_000175026.1.11955 WP_000175026.1.1196 WP_000175026.1.11982 WP_000175026.1.1212 WP_000175026.1.12319 WP_000175026.1.12415 WP_000175026.1.12458 WP_000175026.1.12468 WP_000175026.1.12542 WP_000175026.1.12558 WP_000175026.1.12582 WP_000175026.1.12594 WP_000175026.1.12680 WP_000175026.1.127 WP_000175026.1.12756 WP_000175026.1.12775 WP_000175026.1.12914 WP_000175026.1.13031 WP_000175026.1.1312 WP_000175026.1.13136 WP_000175026.1.13176 WP_000175026.1.13239 WP_000175026.1.13258 WP_000175026.1.13281 WP_000175026.1.13333 WP_000175026.1.1345 WP_000175026.1.13585 WP_000175026.1.13608 WP_000175026.1.13618 WP_000175026.1.13644 WP_000175026.1.13664 WP_000175026.1.13672 WP_000175026.1.13824 WP_000175026.1.13949 WP_000175026.1.13974 WP_000175026.1.14030 WP_000175026.1.1419 WP_000175026.1.14277 WP_000175026.1.14292 WP_000175026.1.14346 WP_000175026.1.1438 WP_000175026.1.14468 WP_000175026.1.14501 WP_000175026.1.14529 WP_000175026.1.1461 WP_000175026.1.14661 WP_000175026.1.1470 WP_000175026.1.14811 WP_000175026.1.14833 WP_000175026.1.14871 WP_000175026.1.14992 WP_000175026.1.15117 WP_000175026.1.1512 WP_000175026.1.15121 WP_000175026.1.15177 WP_000175026.1.15259 WP_000175026.1.153 WP_000175026.1.15496 WP_000175026.1.15538 WP_000175026.1.15576 WP_000175026.1.15645 WP_000175026.1.15740 WP_000175026.1.15747 WP_000175026.1.1588 WP_000175026.1.16086 WP_000175026.1.1609 WP_000175026.1.16102 WP_000175026.1.16111 WP_000175026.1.16179 WP_000175026.1.16294 WP_000175026.1.1634 WP_000175026.1.16435 WP_000175026.1.16500 WP_000175026.1.16532 WP_000175026.1.16541 WP_000175026.1.1655 WP_000175026.1.16577 WP_000175026.1.16612 WP_000175026.1.16715 WP_000175026.1.16721 WP_000175026.1.16752 WP_000175026.1.17018 WP_000175026.1.17084 WP_000175026.1.17087 WP_000175026.1.17114 WP_000175026.1.17119 WP_000175026.1.17123 WP_000175026.1.17150 WP_000175026.1.17216 WP_000175026.1.17282 WP_000175026.1.17290 WP_000175026.1.17432 WP_000175026.1.17534 WP_000175026.1.1755 WP_000175026.1.17577 WP_000175026.1.1763 WP_000175026.1.17831 WP_000175026.1.17952 WP_000175026.1.18133 WP_000175026.1.18134 WP_000175026.1.18329 WP_000175026.1.18381 WP_000175026.1.18402 WP_000175026.1.18550 WP_000175026.1.18699 WP_000175026.1.18726 WP_000175026.1.18858 WP_000175026.1.18876 WP_000175026.1.19075 WP_000175026.1.19100 WP_000175026.1.19150 WP_000175026.1.19194 WP_000175026.1.19205 WP_000175026.1.19206 WP_000175026.1.19277 WP_000175026.1.19313 WP_000175026.1.19361 WP_000175026.1.19441 WP_000175026.1.1963 WP_000175026.1.19644 WP_000175026.1.19655 WP_000175026.1.19684 WP_000175026.1.19691 WP_000175026.1.19795 WP_000175026.1.1982 WP_000175026.1.19878 WP_000175026.1.19889 WP_000175026.1.19940 WP_000175026.1.19957 WP_000175026.1.19994 WP_000175026.1.20151 WP_000175026.1.20164 WP_000175026.1.20308 WP_000175026.1.20318 WP_000175026.1.20331 WP_000175026.1.20445 WP_000175026.1.20506 WP_000175026.1.20515 WP_000175026.1.20536 WP_000175026.1.2063 WP_000175026.1.20638 WP_000175026.1.20691 WP_000175026.1.20724 WP_000175026.1.20737 WP_000175026.1.20943 WP_000175026.1.20958 WP_000175026.1.20982 WP_000175026.1.2100 WP_000175026.1.21020 WP_000175026.1.21057 WP_000175026.1.21122 WP_000175026.1.2142 WP_000175026.1.21470 WP_000175026.1.2156 WP_000175026.1.21661 WP_000175026.1.21733 WP_000175026.1.21758 WP_000175026.1.21771 WP_000175026.1.21915 WP_000175026.1.22060 WP_000175026.1.22113 WP_000175026.1.22314 WP_000175026.1.22359 WP_000175026.1.22363 WP_000175026.1.22574 WP_000175026.1.22579 WP_000175026.1.22632 WP_000175026.1.22649 WP_000175026.1.22669 WP_000175026.1.22690 WP_000175026.1.22783 WP_000175026.1.22830 WP_000175026.1.22878 WP_000175026.1.22885 WP_000175026.1.2300 WP_000175026.1.23044 WP_000175026.1.23090 WP_000175026.1.23378 WP_000175026.1.23511 WP_000175026.1.23549 WP_000175026.1.2362 WP_000175026.1.23676 WP_000175026.1.23812 WP_000175026.1.23898 WP_000175026.1.23945 WP_000175026.1.24045 WP_000175026.1.24089 WP_000175026.1.24124 WP_000175026.1.2428 WP_000175026.1.24362 WP_000175026.1.24499 WP_000175026.1.24583 WP_000175026.1.24616 WP_000175026.1.24876 WP_000175026.1.24899 WP_000175026.1.25042 WP_000175026.1.25085 WP_000175026.1.25126 WP_000175026.1.25141 WP_000175026.1.25183 WP_000175026.1.25203 WP_000175026.1.25324 WP_000175026.1.25525 WP_000175026.1.25643 WP_000175026.1.25713 WP_000175026.1.25832 WP_000175026.1.25843 WP_000175026.1.25996 WP_000175026.1.26048 WP_000175026.1.26379 WP_000175026.1.26480 WP_000175026.1.26517 WP_000175026.1.26588 WP_000175026.1.26609 WP_000175026.1.27057 WP_000175026.1.27098 WP_000175026.1.2712 WP_000175026.1.27134 WP_000175026.1.27214 WP_000175026.1.27260 WP_000175026.1.27451 WP_000175026.1.27560 WP_000175026.1.27742 WP_000175026.1.27774 WP_000175026.1.27879 WP_000175026.1.27923 WP_000175026.1.27971 WP_000175026.1.28128 WP_000175026.1.28268 WP_000175026.1.28271 WP_000175026.1.28371 WP_000175026.1.28509 WP_000175026.1.28662 WP_000175026.1.28697 WP_000175026.1.28711 WP_000175026.1.28760 WP_000175026.1.28809 WP_000175026.1.28919 WP_000175026.1.28982 WP_000175026.1.28994 WP_000175026.1.29016 WP_000175026.1.29061 WP_000175026.1.29128 WP_000175026.1.29221 WP_000175026.1.29239 WP_000175026.1.2926 WP_000175026.1.2942 WP_000175026.1.2945 WP_000175026.1.29746 WP_000175026.1.2995 WP_000175026.1.29967 WP_000175026.1.30004 WP_000175026.1.30231 WP_000175026.1.30247 WP_000175026.1.3045 WP_000175026.1.30472 WP_000175026.1.30479 WP_000175026.1.30497 WP_000175026.1.30546 WP_000175026.1.30554 WP_000175026.1.30630 WP_000175026.1.30639 WP_000175026.1.30733 WP_000175026.1.30783 WP_000175026.1.30866 WP_000175026.1.31000 WP_000175026.1.31142 WP_000175026.1.31211 WP_000175026.1.31379 WP_000175026.1.31407 WP_000175026.1.31421 WP_000175026.1.31614 WP_000175026.1.31681 WP_000175026.1.3169 WP_000175026.1.3181 WP_000175026.1.31833 WP_000175026.1.31839 WP_000175026.1.31898 WP_000175026.1.31928 WP_000175026.1.31978 WP_000175026.1.32093 WP_000175026.1.3212 WP_000175026.1.32121 WP_000175026.1.32127 WP_000175026.1.32143 WP_000175026.1.32394 WP_000175026.1.32479 WP_000175026.1.32509 WP_000175026.1.32601 WP_000175026.1.32661 WP_000175026.1.32722 WP_000175026.1.32815 WP_000175026.1.32903 WP_000175026.1.32984 WP_000175026.1.33004 WP_000175026.1.33238 WP_000175026.1.33244 WP_000175026.1.33325 WP_000175026.1.33385 WP_000175026.1.334 WP_000175026.1.33408 WP_000175026.1.33422 WP_000175026.1.33424 WP_000175026.1.33502 WP_000175026.1.33545 WP_000175026.1.33565 WP_000175026.1.33631 WP_000175026.1.33648 WP_000175026.1.33736 WP_000175026.1.33746 WP_000175026.1.33751 WP_000175026.1.33799 WP_000175026.1.33879 WP_000175026.1.33888 WP_000175026.1.33952 WP_000175026.1.33974 WP_000175026.1.3401 WP_000175026.1.34124 WP_000175026.1.342 WP_000175026.1.34270 WP_000175026.1.34277 WP_000175026.1.34332 WP_000175026.1.34341 WP_000175026.1.34444 WP_000175026.1.34525 WP_000175026.1.34532 WP_000175026.1.34538 WP_000175026.1.347 WP_000175026.1.34727 WP_000175026.1.34982 WP_000175026.1.34990 WP_000175026.1.34993 WP_000175026.1.35195 WP_000175026.1.35204 WP_000175026.1.35211 WP_000175026.1.35360 WP_000175026.1.35651 WP_000175026.1.35724 WP_000175026.1.35740 WP_000175026.1.35904 WP_000175026.1.36164 WP_000175026.1.3620 WP_000175026.1.36334 WP_000175026.1.36386 WP_000175026.1.36496 WP_000175026.1.36531 WP_000175026.1.36627 WP_000175026.1.3671 WP_000175026.1.36746 WP_000175026.1.36747 WP_000175026.1.36817 WP_000175026.1.36833 WP_000175026.1.37057 WP_000175026.1.37122 WP_000175026.1.3723 WP_000175026.1.37233 WP_000175026.1.37261 WP_000175026.1.37433 WP_000175026.1.37445 WP_000175026.1.37485 WP_000175026.1.37576 WP_000175026.1.37588 WP_000175026.1.37750 WP_000175026.1.3788 WP_000175026.1.37897 WP_000175026.1.37964 WP_000175026.1.38080 WP_000175026.1.38085 WP_000175026.1.38105 WP_000175026.1.3811 WP_000175026.1.38182 WP_000175026.1.38211 WP_000175026.1.38363 WP_000175026.1.38371 WP_000175026.1.38485 WP_000175026.1.38533 WP_000175026.1.38544 WP_000175026.1.38636 WP_000175026.1.38843 WP_000175026.1.38950 WP_000175026.1.39164 WP_000175026.1.39356 WP_000175026.1.39365 WP_000175026.1.39367 WP_000175026.1.39430 WP_000175026.1.39541 WP_000175026.1.3980 WP_000175026.1.39829 WP_000175026.1.39870 WP_000175026.1.39938 WP_000175026.1.39961 WP_000175026.1.39966 WP_000175026.1.39970 WP_000175026.1.39992 WP_000175026.1.39998 WP_000175026.1.40013 WP_000175026.1.40016 WP_000175026.1.40192 WP_000175026.1.40212 WP_000175026.1.40218 WP_000175026.1.40317 WP_000175026.1.40389 WP_000175026.1.40445 WP_000175026.1.40499 WP_000175026.1.40524 WP_000175026.1.40548 WP_000175026.1.406 WP_000175026.1.40666 WP_000175026.1.40712 WP_000175026.1.40815 WP_000175026.1.40833 WP_000175026.1.40898 WP_000175026.1.40912 WP_000175026.1.40937 WP_000175026.1.40965 WP_000175026.1.41206 WP_000175026.1.4126 WP_000175026.1.41346 WP_000175026.1.41363 WP_000175026.1.41436 WP_000175026.1.41484 WP_000175026.1.41530 WP_000175026.1.41556 WP_000175026.1.41621 WP_000175026.1.41782 WP_000175026.1.41813 WP_000175026.1.41826 WP_000175026.1.41900 WP_000175026.1.42022 WP_000175026.1.42073 WP_000175026.1.42113 WP_000175026.1.42209 WP_000175026.1.42214 WP_000175026.1.42233 WP_000175026.1.42318 WP_000175026.1.42376 WP_000175026.1.4242 WP_000175026.1.42432 WP_000175026.1.42547 WP_000175026.1.42632 WP_000175026.1.42770 WP_000175026.1.4282 WP_000175026.1.42879 WP_000175026.1.4290 WP_000175026.1.42936 WP_000175026.1.42989 WP_000175026.1.43035 WP_000175026.1.43174 WP_000175026.1.43270 WP_000175026.1.43444 WP_000175026.1.43473 WP_000175026.1.43489 WP_000175026.1.43622 WP_000175026.1.43720 WP_000175026.1.43989 WP_000175026.1.44088 WP_000175026.1.44096 WP_000175026.1.44100 WP_000175026.1.44115 WP_000175026.1.44162 WP_000175026.1.44166 WP_000175026.1.44211 WP_000175026.1.44324 WP_000175026.1.44365 WP_000175026.1.44458 WP_000175026.1.44558 WP_000175026.1.44610 WP_000175026.1.44724 WP_000175026.1.44821 WP_000175026.1.44841 WP_000175026.1.44849 WP_000175026.1.44854 WP_000175026.1.44923 WP_000175026.1.44960 WP_000175026.1.44970 WP_000175026.1.44980 WP_000175026.1.45025 WP_000175026.1.45028 WP_000175026.1.45043 WP_000175026.1.45116 WP_000175026.1.4516 WP_000175026.1.45208 WP_000175026.1.45246 WP_000175026.1.45313 WP_000175026.1.45329 WP_000175026.1.45440 WP_000175026.1.4549 WP_000175026.1.45581 WP_000175026.1.45595 WP_000175026.1.4574 WP_000175026.1.45741 WP_000175026.1.45752 WP_000175026.1.4593 WP_000175026.1.45933 WP_000175026.1.46026 WP_000175026.1.46115 WP_000175026.1.46186 WP_000175026.1.46213 WP_000175026.1.46325 WP_000175026.1.46329 WP_000175026.1.46441 WP_000175026.1.46582 WP_000175026.1.4670 WP_000175026.1.46802 WP_000175026.1.46820 WP_000175026.1.46909 WP_000175026.1.46932 WP_000175026.1.47038 WP_000175026.1.47048 WP_000175026.1.47063 WP_000175026.1.47156 WP_000175026.1.47186 WP_000175026.1.4722 WP_000175026.1.47224 WP_000175026.1.47322 WP_000175026.1.47386 WP_000175026.1.47401 WP_000175026.1.47414 WP_000175026.1.47496 WP_000175026.1.47634 WP_000175026.1.47646 WP_000175026.1.47673 WP_000175026.1.4772 WP_000175026.1.47740 WP_000175026.1.47765 WP_000175026.1.47791 WP_000175026.1.48040 WP_000175026.1.48048 WP_000175026.1.48080 WP_000175026.1.48096 WP_000175026.1.48111 WP_000175026.1.48194 WP_000175026.1.48203 WP_000175026.1.48290 WP_000175026.1.48353 WP_000175026.1.48371 WP_000175026.1.48477 WP_000175026.1.48522 WP_000175026.1.486 WP_000175026.1.4871 WP_000175026.1.48860 WP_000175026.1.48926 WP_000175026.1.48953 WP_000175026.1.48970 WP_000175026.1.48974 WP_000175026.1.49009 WP_000175026.1.49236 WP_000175026.1.49363 WP_000175026.1.49531 WP_000175026.1.49537 WP_000175026.1.49645 WP_000175026.1.49661 WP_000175026.1.497 WP_000175026.1.49733 WP_000175026.1.49740 WP_000175026.1.49768 WP_000175026.1.49883 WP_000175026.1.49900 WP_000175026.1.50006 WP_000175026.1.50008 WP_000175026.1.50078 WP_000175026.1.5017 WP_000175026.1.50262 WP_000175026.1.50266 WP_000175026.1.50452 WP_000175026.1.5056 WP_000175026.1.50564 WP_000175026.1.50579 WP_000175026.1.5067 WP_000175026.1.50717 WP_000175026.1.51042 WP_000175026.1.5106 WP_000175026.1.51172 WP_000175026.1.51255 WP_000175026.1.51300 WP_000175026.1.51425 WP_000175026.1.51441 WP_000175026.1.5146 WP_000175026.1.51495 WP_000175026.1.51539 WP_000175026.1.51552 WP_000175026.1.51587 WP_000175026.1.51607 WP_000175026.1.51873 WP_000175026.1.51968 WP_000175026.1.52002 WP_000175026.1.52020 WP_000175026.1.52062 WP_000175026.1.52076 WP_000175026.1.52127 WP_000175026.1.52135 WP_000175026.1.52186 WP_000175026.1.52211 WP_000175026.1.52214 WP_000175026.1.52243 WP_000175026.1.52305 WP_000175026.1.52399 WP_000175026.1.52492 WP_000175026.1.52524 WP_000175026.1.52544 WP_000175026.1.52558 WP_000175026.1.5265 WP_000175026.1.5272 WP_000175026.1.52774 WP_000175026.1.52780 WP_000175026.1.52844 WP_000175026.1.52852 WP_000175026.1.52853 WP_000175026.1.52895 WP_000175026.1.53012 WP_000175026.1.53020 WP_000175026.1.53110 WP_000175026.1.53244 WP_000175026.1.53327 WP_000175026.1.53377 WP_000175026.1.53428 WP_000175026.1.53482 WP_000175026.1.53545 WP_000175026.1.53594 WP_000175026.1.53645 WP_000175026.1.53769 WP_000175026.1.53931 WP_000175026.1.53972 WP_000175026.1.53994 WP_000175026.1.54002 WP_000175026.1.54028 WP_000175026.1.54263 WP_000175026.1.54329 WP_000175026.1.54344 WP_000175026.1.54463 WP_000175026.1.54507 WP_000175026.1.54602 WP_000175026.1.5461 WP_000175026.1.54617 WP_000175026.1.54620 WP_000175026.1.54625 WP_000175026.1.5470 WP_000175026.1.54769 WP_000175026.1.54981 WP_000175026.1.55003 WP_000175026.1.55005 WP_000175026.1.55112 WP_000175026.1.55123 WP_000175026.1.55203 WP_000175026.1.55374 WP_000175026.1.55424 WP_000175026.1.55425 WP_000175026.1.55466 WP_000175026.1.55507 WP_000175026.1.55529 WP_000175026.1.55551 WP_000175026.1.55556 WP_000175026.1.55571 WP_000175026.1.55574 WP_000175026.1.55629 WP_000175026.1.55676 WP_000175026.1.55720 WP_000175026.1.55825 WP_000175026.1.55868 WP_000175026.1.5614 WP_000175026.1.56164 WP_000175026.1.56436 WP_000175026.1.56786 WP_000175026.1.56789 WP_000175026.1.56846 WP_000175026.1.56932 WP_000175026.1.56934 WP_000175026.1.56978 WP_000175026.1.56980 WP_000175026.1.57181 WP_000175026.1.57386 WP_000175026.1.57401 WP_000175026.1.57403 WP_000175026.1.57410 WP_000175026.1.57414 WP_000175026.1.57432 WP_000175026.1.57719 WP_000175026.1.57846 WP_000175026.1.5786 WP_000175026.1.57904 WP_000175026.1.58060 WP_000175026.1.58080 WP_000175026.1.58232 WP_000175026.1.58316 WP_000175026.1.58384 WP_000175026.1.58401 WP_000175026.1.5842 WP_000175026.1.58420 WP_000175026.1.58429 WP_000175026.1.58440 WP_000175026.1.58475 WP_000175026.1.58837 WP_000175026.1.58867 WP_000175026.1.58940 WP_000175026.1.58951 WP_000175026.1.58958 WP_000175026.1.58976 WP_000175026.1.59024 WP_000175026.1.59026 WP_000175026.1.59035 WP_000175026.1.59306 WP_000175026.1.59407 WP_000175026.1.59513 WP_000175026.1.59533 WP_000175026.1.59553 WP_000175026.1.59590 WP_000175026.1.59615 WP_000175026.1.5965 WP_000175026.1.59998 WP_000175026.1.6002 WP_000175026.1.60031 WP_000175026.1.60067 WP_000175026.1.60151 WP_000175026.1.60343 WP_000175026.1.60477 WP_000175026.1.60498 WP_000175026.1.60505 WP_000175026.1.60550 WP_000175026.1.60576 WP_000175026.1.6061 WP_000175026.1.6066 WP_000175026.1.60717 WP_000175026.1.60764 WP_000175026.1.60895 WP_000175026.1.60901 WP_000175026.1.61005 WP_000175026.1.6106 WP_000175026.1.61096 WP_000175026.1.61102 WP_000175026.1.61170 WP_000175026.1.61181 WP_000175026.1.61183 WP_000175026.1.61241 WP_000175026.1.61505 WP_000175026.1.61517 WP_000175026.1.61663 WP_000175026.1.61779 WP_000175026.1.61822 WP_000175026.1.61858 WP_000175026.1.61949 WP_000175026.1.62099 WP_000175026.1.62612 WP_000175026.1.62642 WP_000175026.1.62668 WP_000175026.1.62735 WP_000175026.1.62750 WP_000175026.1.62787 WP_000175026.1.62812 WP_000175026.1.62840 WP_000175026.1.62919 WP_000175026.1.62989 WP_000175026.1.63167 WP_000175026.1.6323 WP_000175026.1.63246 WP_000175026.1.6337 WP_000175026.1.63453 WP_000175026.1.63478 WP_000175026.1.63721 WP_000175026.1.64040 WP_000175026.1.64080 WP_000175026.1.64110 WP_000175026.1.6416 WP_000175026.1.64285 WP_000175026.1.6431 WP_000175026.1.64448 WP_000175026.1.647 WP_000175026.1.64749 WP_000175026.1.64784 WP_000175026.1.64789 WP_000175026.1.64912 WP_000175026.1.64926 WP_000175026.1.6499 WP_000175026.1.65040 WP_000175026.1.65256 WP_000175026.1.65271 WP_000175026.1.65353 WP_000175026.1.65364 WP_000175026.1.65415 WP_000175026.1.65596 WP_000175026.1.65912 WP_000175026.1.65961 WP_000175026.1.66050 WP_000175026.1.66104 WP_000175026.1.66105 WP_000175026.1.66127 WP_000175026.1.66251 WP_000175026.1.66327 WP_000175026.1.6635 WP_000175026.1.66387 WP_000175026.1.66389 WP_000175026.1.66395 WP_000175026.1.66501 WP_000175026.1.6654 WP_000175026.1.66559 WP_000175026.1.66624 WP_000175026.1.6665 WP_000175026.1.66700 WP_000175026.1.66719 WP_000175026.1.66933 WP_000175026.1.67021 WP_000175026.1.67022 WP_000175026.1.67137 WP_000175026.1.67293 WP_000175026.1.67415 WP_000175026.1.67468 WP_000175026.1.67538 WP_000175026.1.67553 WP_000175026.1.67660 WP_000175026.1.67732 WP_000175026.1.67786 WP_000175026.1.67787 WP_000175026.1.67853 WP_000175026.1.67861 WP_000175026.1.67975 WP_000175026.1.68008 WP_000175026.1.6803 WP_000175026.1.68170 WP_000175026.1.68215 WP_000175026.1.68283 WP_000175026.1.68341 WP_000175026.1.68396 WP_000175026.1.68534 WP_000175026.1.68697 WP_000175026.1.68711 WP_000175026.1.6877 WP_000175026.1.68797 WP_000175026.1.68865 WP_000175026.1.68915 WP_000175026.1.68989 WP_000175026.1.69127 WP_000175026.1.6916 WP_000175026.1.6923 WP_000175026.1.69247 WP_000175026.1.69258 WP_000175026.1.69261 WP_000175026.1.69303 WP_000175026.1.69305 WP_000175026.1.69473 WP_000175026.1.69583 WP_000175026.1.69646 WP_000175026.1.69803 WP_000175026.1.6993 WP_000175026.1.70407 WP_000175026.1.70619 WP_000175026.1.70767 WP_000175026.1.70794 WP_000175026.1.70880 WP_000175026.1.71024 WP_000175026.1.71159 WP_000175026.1.71199 WP_000175026.1.71229 WP_000175026.1.71272 WP_000175026.1.71285 WP_000175026.1.71312 WP_000175026.1.71315 WP_000175026.1.71323 WP_000175026.1.71397 WP_000175026.1.71403 WP_000175026.1.71409 WP_000175026.1.71480 WP_000175026.1.71522 WP_000175026.1.71690 WP_000175026.1.71783 WP_000175026.1.71837 WP_000175026.1.71938 WP_000175026.1.71944 WP_000175026.1.71975 WP_000175026.1.71993 WP_000175026.1.72033 WP_000175026.1.7210 WP_000175026.1.72157 WP_000175026.1.72184 WP_000175026.1.72279 WP_000175026.1.72337 WP_000175026.1.72397 WP_000175026.1.72431 WP_000175026.1.72485 WP_000175026.1.72511 WP_000175026.1.72537 WP_000175026.1.72544 WP_000175026.1.72606 WP_000175026.1.72616 WP_000175026.1.72745 WP_000175026.1.72747 WP_000175026.1.72860 WP_000175026.1.72910 WP_000175026.1.72947 WP_000175026.1.73085 WP_000175026.1.73129 WP_000175026.1.73217 WP_000175026.1.73292 WP_000175026.1.73295 WP_000175026.1.73385 WP_000175026.1.73524 WP_000175026.1.73565 WP_000175026.1.73604 WP_000175026.1.73717 WP_000175026.1.7376 WP_000175026.1.73835 WP_000175026.1.73843 WP_000175026.1.73844 WP_000175026.1.73859 WP_000175026.1.73942 WP_000175026.1.7411 WP_000175026.1.74123 WP_000175026.1.74184 WP_000175026.1.74309 WP_000175026.1.74365 WP_000175026.1.74445 WP_000175026.1.74520 WP_000175026.1.74528 WP_000175026.1.7461 WP_000175026.1.74625 WP_000175026.1.74688 WP_000175026.1.74691 WP_000175026.1.74713 WP_000175026.1.7475 WP_000175026.1.74962 WP_000175026.1.74998 WP_000175026.1.75139 WP_000175026.1.75145 WP_000175026.1.75149 WP_000175026.1.75209 WP_000175026.1.75243 WP_000175026.1.75272 WP_000175026.1.75367 WP_000175026.1.75428 WP_000175026.1.75491 WP_000175026.1.75515 WP_000175026.1.75537 WP_000175026.1.75612 WP_000175026.1.75644 WP_000175026.1.75653 WP_000175026.1.75672 WP_000175026.1.75679 WP_000175026.1.75687 WP_000175026.1.75699 WP_000175026.1.75735 WP_000175026.1.75983 WP_000175026.1.75995 WP_000175026.1.76039 WP_000175026.1.76184 WP_000175026.1.76196 WP_000175026.1.76211 WP_000175026.1.76312 WP_000175026.1.76361 WP_000175026.1.76446 WP_000175026.1.76462 WP_000175026.1.76547 WP_000175026.1.76562 WP_000175026.1.76701 WP_000175026.1.76707 WP_000175026.1.76712 WP_000175026.1.76815 WP_000175026.1.76909 WP_000175026.1.77175 WP_000175026.1.77214 WP_000175026.1.77291 WP_000175026.1.77471 WP_000175026.1.77595 WP_000175026.1.77636 WP_000175026.1.77648 WP_000175026.1.77768 WP_000175026.1.77876 WP_000175026.1.78000 WP_000175026.1.78007 WP_000175026.1.78089 WP_000175026.1.78196 WP_000175026.1.78235 WP_000175026.1.78321 WP_000175026.1.78413 WP_000175026.1.7847 WP_000175026.1.78481 WP_000175026.1.78583 WP_000175026.1.78612 WP_000175026.1.78615 WP_000175026.1.78750 WP_000175026.1.78953 WP_000175026.1.7896 WP_000175026.1.79004 WP_000175026.1.79086 WP_000175026.1.79312 WP_000175026.1.79369 WP_000175026.1.79478 WP_000175026.1.79505 WP_000175026.1.79558 WP_000175026.1.79685 WP_000175026.1.79764 WP_000175026.1.79840 WP_000175026.1.7985 WP_000175026.1.7987 WP_000175026.1.79871 WP_000175026.1.79931 WP_000175026.1.79984 WP_000175026.1.80050 WP_000175026.1.80060 WP_000175026.1.80136 WP_000175026.1.80179 WP_000175026.1.80183 WP_000175026.1.80255 WP_000175026.1.80320 WP_000175026.1.80428 WP_000175026.1.80440 WP_000175026.1.80444 WP_000175026.1.80517 WP_000175026.1.80524 WP_000175026.1.8057 WP_000175026.1.80612 WP_000175026.1.80626 WP_000175026.1.80662 WP_000175026.1.80666 WP_000175026.1.80768 WP_000175026.1.80804 WP_000175026.1.80805 WP_000175026.1.80884 WP_000175026.1.8090 WP_000175026.1.81054 WP_000175026.1.81127 WP_000175026.1.81286 WP_000175026.1.81313 WP_000175026.1.81577 WP_000175026.1.81589 WP_000175026.1.81618 WP_000175026.1.81715 WP_000175026.1.81723 WP_000175026.1.81806 WP_000175026.1.81832 WP_000175026.1.81935 WP_000175026.1.81939 WP_000175026.1.82275 WP_000175026.1.82316 WP_000175026.1.8235 WP_000175026.1.82439 WP_000175026.1.82536 WP_000175026.1.82647 WP_000175026.1.82700 WP_000175026.1.82715 WP_000175026.1.82754 WP_000175026.1.82853 WP_000175026.1.83020 WP_000175026.1.8308 WP_000175026.1.83093 WP_000175026.1.83097 WP_000175026.1.831 WP_000175026.1.83140 WP_000175026.1.83144 WP_000175026.1.83205 WP_000175026.1.83224 WP_000175026.1.83415 WP_000175026.1.83537 WP_000175026.1.83544 WP_000175026.1.83735 WP_000175026.1.83781 WP_000175026.1.83941 WP_000175026.1.8411 WP_000175026.1.84210 WP_000175026.1.84298 WP_000175026.1.84331 WP_000175026.1.84339 WP_000175026.1.84405 WP_000175026.1.84410 WP_000175026.1.8444 WP_000175026.1.84467 WP_000175026.1.84534 WP_000175026.1.84584 WP_000175026.1.84738 WP_000175026.1.84740 WP_000175026.1.84875 WP_000175026.1.84972 WP_000175026.1.84977 WP_000175026.1.84989 WP_000175026.1.84994 WP_000175026.1.85002 WP_000175026.1.85052 WP_000175026.1.85247 WP_000175026.1.85255 WP_000175026.1.85260 WP_000175026.1.85310 WP_000175026.1.85323 WP_000175026.1.85500 WP_000175026.1.85621 WP_000175026.1.85752 WP_000175026.1.85773 WP_000175026.1.8592 WP_000175026.1.85948 WP_000175026.1.86001 WP_000175026.1.86016 WP_000175026.1.86161 WP_000175026.1.86189 WP_000175026.1.8621 WP_000175026.1.86228 WP_000175026.1.86276 WP_000175026.1.86412 WP_000175026.1.86452 WP_000175026.1.86461 WP_000175026.1.86475 WP_000175026.1.86609 WP_000175026.1.86691 WP_000175026.1.86760 WP_000175026.1.86787 WP_000175026.1.86848 WP_000175026.1.86959 WP_000175026.1.86997 WP_000175026.1.87199 WP_000175026.1.87389 WP_000175026.1.87563 WP_000175026.1.87574 WP_000175026.1.87610 WP_000175026.1.87655 WP_000175026.1.87721 WP_000175026.1.87857 WP_000175026.1.87914 WP_000175026.1.87919 WP_000175026.1.88017 WP_000175026.1.88110 WP_000175026.1.88301 WP_000175026.1.88304 WP_000175026.1.88434 WP_000175026.1.88607 WP_000175026.1.88667 WP_000175026.1.88710 WP_000175026.1.88729 WP_000175026.1.88757 WP_000175026.1.8879 WP_000175026.1.88834 WP_000175026.1.88950 WP_000175026.1.88961 WP_000175026.1.89090 WP_000175026.1.89099 WP_000175026.1.89416 WP_000175026.1.89458 WP_000175026.1.89468 WP_000175026.1.89471 WP_000175026.1.89674 WP_000175026.1.89679 WP_000175026.1.89899 WP_000175026.1.89923 WP_000175026.1.89927 WP_000175026.1.90017 WP_000175026.1.90078 WP_000175026.1.90168 WP_000175026.1.90256 WP_000175026.1.90358 WP_000175026.1.9036 WP_000175026.1.90389 WP_000175026.1.90511 WP_000175026.1.90520 WP_000175026.1.90536 WP_000175026.1.90703 WP_000175026.1.90799 WP_000175026.1.90828 WP_000175026.1.90865 WP_000175026.1.90951 WP_000175026.1.91018 WP_000175026.1.91121 WP_000175026.1.91170 WP_000175026.1.91277 WP_000175026.1.91340 WP_000175026.1.91341 WP_000175026.1.91445 WP_000175026.1.91462 WP_000175026.1.91551 WP_000175026.1.91640 WP_000175026.1.9169 WP_000175026.1.91739 WP_000175026.1.91850 WP_000175026.1.91994 WP_000175026.1.92019 WP_000175026.1.9215 WP_000175026.1.92161 WP_000175026.1.92180 WP_000175026.1.92224 WP_000175026.1.92323 WP_000175026.1.92361 WP_000175026.1.92496 WP_000175026.1.92568 WP_000175026.1.92614 WP_000175026.1.92615 WP_000175026.1.9264 WP_000175026.1.92742 WP_000175026.1.92792 WP_000175026.1.92845 WP_000175026.1.92865 WP_000175026.1.92943 WP_000175026.1.92989 WP_000175026.1.93019 WP_000175026.1.93048 WP_000175026.1.93054 WP_000175026.1.93175 WP_000175026.1.93276 WP_000175026.1.93309 WP_000175026.1.93312 WP_000175026.1.93629 WP_000175026.1.93634 WP_000175026.1.93652 WP_000175026.1.93673 WP_000175026.1.93755 WP_000175026.1.93911 WP_000175026.1.94025 WP_000175026.1.94057 WP_000175026.1.94176 WP_000175026.1.94187 WP_000175026.1.94271 WP_000175026.1.94388 WP_000175026.1.94445 WP_000175026.1.94542 WP_000175026.1.9457 WP_000175026.1.94626 WP_000175026.1.94692 WP_000175026.1.94695 WP_000175026.1.94738 WP_000175026.1.94764 WP_000175026.1.948 WP_000175026.1.9489 WP_000175026.1.94898 WP_000175026.1.94938 WP_000175026.1.94949 WP_000175026.1.94993 WP_000175026.1.95037 WP_000175026.1.95332 WP_000175026.1.95395 WP_000175026.1.95595 WP_000175026.1.95827 WP_000175026.1.95849 WP_000175026.1.95919 WP_000175026.1.95931 WP_000175026.1.95932 WP_000175026.1.96015 WP_000175026.1.96215 WP_000175026.1.96281 WP_000175026.1.96299 WP_000175026.1.96303 WP_000175026.1.96394 WP_000175026.1.96417 WP_000175026.1.96479 WP_000175026.1.96984 WP_000175026.1.97011 WP_000175026.1.97119 WP_000175026.1.97123 WP_000175026.1.97231 WP_000175026.1.97418 WP_000175026.1.97439 WP_000175026.1.9747 WP_000175026.1.97560 WP_000175026.1.97619 WP_000175026.1.97825 WP_000175026.1.97930 WP_000175026.1.97982 WP_000175026.1.97996 WP_000175026.1.98012 WP_000175026.1.98220 WP_000175026.1.98235 WP_000175026.1.98241 WP_000175026.1.98244 WP_000175026.1.98294 WP_000175026.1.98355 WP_000175026.1.98424 WP_000175026.1.98442 WP_000175026.1.98477 WP_000175026.1.98578 WP_000175026.1.98614 WP_000175026.1.98628 WP_000175026.1.9864 WP_000175026.1.98776 WP_000175026.1.99265 WP_000175026.1.99310 WP_000175026.1.99392 WP_000175026.1.99400 WP_000175026.1.99453 WP_000175026.1.99602 WP_000175026.1.99929 gi|471333581|ref|YP_007557058.1| gi|170081397|ref|YP_001730717.1| cath|current|1wxeA00/2-275 cath|current|1wxfA00/2-275 cath|current|1wxgA00/2-275 cath|current|1wxhA00/2-275 cath|current|1wxiA00/2-275 gi|238900954|ref|YP_002926750.1| gi|388477813|ref|YP_490001.1| gi|386614291|ref|YP_006133957.1| gi|387621458|ref|YP_006129085.1| gi|157161200|ref|YP_001458518.1| gi|170019913|ref|YP_001724867.1| 1wxe_A 1wxf_A 1wxg_A 1wxh_A 1wxi_A gi|387621458|ref|YP_006129085.1| 1wxiA gi|16129694|ref|NP_416254.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]