SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wy5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wy5A
Domain Number 1 Region: 6-215
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.24e-55
Family PP-loop ATPase 0.00000000397
Further Details:      
 
Domain Number 2 Region: 218-311
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 1.61e-21
Family MesJ substrate recognition domain-like 0.0000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1wy5A   PDB: 1wy5
Sequence length 317
Comment (A:)
Sequence
MNPESRVIRKVLALQNDEKIFSGERRVLIAFSGGVDSVVLTDVLLKLKNYFSLKEVALAH
FNHMLRESAERDEEFCKEFAKERNMKIFVGKEDVRAFAKENRMSLEEAGRFLRYKFLKEI
LESEGFDCIATAHHLNDLLETSLLFFTRGTGLDGLIGFLPKEEVIRRPLYYVKRSEIEEY
AKFKGLRWVEDETNYEVSIPRNRIRHRVIPELKRINENLEDTFLKMVKVLRAEREFLEEE
AQKLYKEVKKGNCLDVKKLKEKPLALQRRVIRKFIGEKDYEKVELVRSLLEKGGEVNLGK
GKVLKRKERWLCFSPEV
Download sequence
Identical sequences O67728
224324.aq_1887 gi|15606915|ref|NP_214296.1| NP_214296.1.100253 1wy5_A 1wy5_B 2e21_A 2e21_B 2e21_C 2e21_D 2e89_A 2e89_B 2e89_C 2e89_D 1wy5A aae001001887.2 aae001001887.3 aae001001887.4 aae001001887.5 ar_001000718.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]