SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1x2gA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1x2gA
Domain Number 1 Region: 7-246
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.88e-87
Family LplA-like 0.0000000209
Further Details:      
 
Domain Number 2 Region: 247-334
Classification Level Classification E-value
Superfamily SufE/NifU 1.07e-24
Family SP1160 C-terminal domain-like 0.00000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1x2gA   PDB: 1x2g
Sequence length 337
Comment (A:)
Sequence
stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
wewnfgqapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgc
lyradmlqqeceallvdfpeqekelrelsawmagavr
Download sequence
Identical sequences 1x2gA 1x2g_A 1x2g_B 1x2g_C 1x2h_A 1x2h_B 1x2h_C 3a7a_A 3a7a_C 3a7r_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]