SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1x2mA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1x2mA
Domain Number 1 Region: 8-58
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000299
Family Homeodomain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1x2mA   PDB: 1x2m
Sequence length 64
Comment (A:)
Sequence
gssgssgtaqpnailekvftaitkhpdekrleglskqldwdvrsiqrwfrqrrnqekpsg
pssg
Download sequence
Identical sequences 1x2m_A 1x2mA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]