SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1x2nA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1x2nA
Domain Number 1 Region: 15-65
Classification Level Classification E-value
Superfamily Homeodomain-like 9.45e-34
Family Homeodomain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1x2nA   PDB: 1x2n
Sequence length 73
Comment (A:)
Sequence
gssgssgknkrgvlpkhatnvmrswlfqhighpyptedekkqiaaqtnltllqvnnwfin
arrrilqsgpssg
Download sequence
Identical sequences 1x2nA 1x2n_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]