SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1x38A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1x38A
Domain Number 1 Region: 15-37,83-361
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.11e-144
Family NagZ-like 0.0000000000695
Further Details:      
 
Domain Number 2 Region: 389-598
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 1.02e-56
Family Beta-D-glucan exohydrolase, C-terminal domain 0.00000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1x38A   PDB: 1x38
Sequence length 602
Comment (A:)
Sequence
dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl
qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpagsdy
sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
npyadpamaeqlgkqehrdlareaarkslvllkngktstdapllplpkkapkilvagsha
dnlgyqcggwtiewqgdtgrttvgttileavkaavdpstvvvfaenpdaefvksggfsya
ivavgehpytetkgdnlnltipepglstvqavcggvrcatvlisgrpvvvqpllaasdal
vaawlpgsegqgvtdalfgdfgftgrlprtwfksvdqlpmnvgdahydplfrlgyglttn
at
Download sequence
Identical sequences 1lq2_A 1x38_A 1x39_A 1x38A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]