SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1x41A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1x41A
Domain Number 1 Region: 6-55
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000266
Family Homeodomain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1x41A   PDB: 1x41
Sequence length 60
Comment (A:)
Sequence
gssgssgdpswtaqeemalleavmdcgfgnwqdvanqmctktkeecekhymkyfsgpssg
Download sequence
Identical sequences 1x41A 1x41_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]