SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1x4oA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1x4oA
Domain Number 1 Region: 8-72
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 2.05e-18
Family Surp module (SWAP domain) 0.0000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1x4oA   PDB: 1x4o
Sequence length 78
Comment (A:)
Sequence
gssgssgkvsppedeeaknlaeklarfiadggpevetialqnnrenqafsflydpnsqgy
ryyrqkldefrksgpssg
Download sequence
Identical sequences 1x4oA 1x4o_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]