SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1x4pA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1x4pA
Domain Number 1 Region: 9-59
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.00000000000000146
Family Surp module (SWAP domain) 0.0000607
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1x4pA   PDB: 1x4p
Sequence length 66
Comment (A:)
Sequence
gssgssgvgtidqlvkrviegslspkertllkedpaywflsdensleykyyklklaemqr
sgpssg
Download sequence
Identical sequences 1x4pA 1x4p_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]