SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1x58A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1x58A
Domain Number 1 Region: 8-55
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000486
Family Homeodomain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1x58A   PDB: 1x58
Sequence length 62
Comment (A:)
Sequence
gssgssgrkdftkeevnylfhgvktmgnhwnsilwsfpfqkgrravdlahkyhrlisgps
sg
Download sequence
Identical sequences 1x58A 1x58_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]