SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1x7dA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1x7dA
Domain Number 1 Region: 2-338
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.07e-101
Family Ornithine cyclodeaminase-like 0.0000000000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1x7dA   PDB: 1x7d   SUPERFAMILY: 1x7dA
Sequence length 350
Comment (A:)
Sequence
MTYFIDVPTMSDLVHDIGVAPFIGELAAALRDDFKRWQAFDKSARVASHSEVGVIELMPV
ADKSRYAFKYVNGHPANTARNLHTVMAFGVLADVDSGYPVLLSELTIATALRTAATSLMA
AQALARPNARKMALIGNGAQSEFQALAFHKHLGIEEIVAYDTDPLATAKLIANLKEYSGL
TIRRASSVAEAVKGVDIITTVTADKAYATIITPDMLEPGMHLNAVGGDCPGKTELHADVL
RNARVFVEYEPQTRIEGEIQQLPADFPVVDLWRVLRGETEGRQSDSQVTVFDSVGFALED
YTVLRYVLQQAEKRGMGTKIDLVPWVEDDPKDLFSHTRGRAGKRRIRRVA
Download sequence
Identical sequences Q88H32
1u7h_A 1u7h_B 1x7d_A 1x7d_B 1x7dA gi|26990245|ref|NP_745670.1| NP_745670.1.35174 WP_010954390.1.28295 WP_010954390.1.28475 WP_010954390.1.3142 WP_010954390.1.58218 WP_010954390.1.71439 WP_010954390.1.87606 160488.PP_3533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]