SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1x7vA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1x7vA
Domain Number 1 Region: 6-79
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 3.62e-35
Family PA3566-like 0.0000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1x7vA   PDB: 1x7v   SUPERFAMILY: 1x7vA
Sequence length 99
Comment (A:)
Sequence
ghmstpltliatitaapghaealerelralvapsraeagclqydlhqdrhdshlfymieq
wrddaalerhqntehflrfsrgneallqnvkidqlyrla
Download sequence
Identical sequences 1x7v_A 1x7v_B 1x7v_C 1x7vA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]