SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1x9lA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1x9lA
Domain Number 1 Region: 12-145
Classification Level Classification E-value
Superfamily DR1885-like metal-binding protein 1.61e-39
Family DR1885-like metal-binding protein 0.000000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1x9lA   PDB: 1x9l   SUPERFAMILY: 1x9lA
Sequence length 149
Comment (A:)
Sequence
mghtmpahtppaqtapaaqkagaqalpvtvqgatvaavppsirdtaaymtltnksdqpik
lvgaatplatspmlmttthsggmagmkmvpwltipargtltlqrdgdhvmlmglkrplkv
getvnitlkatdgrtlnvaatvkkniegr
Download sequence
Identical sequences 1x9lA 1x9l_A 2jqa_A 000001875|e1x9lA1|11.1.5.18|A:1-149 000041264|e2jqaA1|11.1.5.18|A:1-149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]