SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xc5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xc5A
Domain Number 1 Region: 6-70
Classification Level Classification E-value
Superfamily Homeodomain-like 1.33e-18
Family Myb/SANT domain 0.0000854
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xc5A   PDB: 1xc5
Sequence length 71
Comment (A:)
Sequence
gsmnglmadpmkvykdrqvmnmwseqeketfrekfmqhpknfgliasflerktvaecvly
yyltkknenyk
Download sequence
Identical sequences 1xc5A 1xc5_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]