SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xipA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xipA
Domain Number 1 Region: 3-382
Classification Level Classification E-value
Superfamily Nucleoporin domain 1.02e-61
Family Nucleoporin domain 0.000000000000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xipA   PDB: 1xip   SUPERFAMILY: 1xipA
Sequence length 388
Comment (A:)
Sequence
gasslkdevptetsedfgfkflgqkqilpsfneklpfaslqnldisnskslfvaasgska
vvgelqllrdhitsdstpltfkwekeipdvifvcfhgdqvlvstrnalysldleelsefr
tvtsfekpvfqlknvnntlvilnsvndlsaldlrtkstkqlaqnvtsfdvtnsqlavllk
drsfqsfawrngemekqfefslpseleelpveeysplsvtilspqdflavfgnvisetdd
evsydqkmyiikhidgsasfqetfditppfgqivrfpymykvtlsgliepdanvnvlass
cssevsiwdskqviepsqdseravlpiseetdkdtnpigvavdvvtsgtilepcsgvdti
erlplvyilnnegslqivglfhvaaiks
Download sequence
Identical sequences cath|current|3pezC00/0-381 cath|current|3rrmC00/0-381 1xipA 1xip_A 3rrm_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]