SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xksA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xksA
Domain Number 1 Region: 11-413
Classification Level Classification E-value
Superfamily Nucleoporin domain 4.54e-153
Family Nucleoporin domain 0.000000000000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xksA   PDB: 1xks   SUPERFAMILY: 1xksA
Sequence length 450
Comment (A:)
Sequence
gsmfphhsitesvnydvktfgsslpvkvmealtlaevddqltinideggwaclvckekli
iwkialspitklsvckelqlppsdfhwsadlvalsysspsgeahstqavavmvatregsi
rywpslagedtyteafvdsggdktysfltavqggsfilsssgsqlirlipessgkihqhi
lpqgqgmlsgigrkvsslfgilspssdltlssvlwdrerssfysltssniskwelddsse
khayswdinralkenitdaiwgsesnyeaikegvniryldlkqncdglvilaaawhsadn
pcliyyslitiedngcqmsdavtvevtqynppfqsedlilcqltvpnfsnqtaylynesa
vyvcstgtgkfslpqekivfnaqgdsvlgagacggvpiifsrnsglvsitsrenvsilae
dlegslassvagpnsesmifetttknetia
Download sequence
Identical sequences 1xksA 1xks_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]