SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xltC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xltC
Domain Number 1 Region: 4-173
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.93e-142
Family Transhydrogenase domain III (dIII) 0.0000000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xltC   PDB: 1xlt
Sequence length 174
Comment (C:)
Sequence
rhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
Download sequence
Identical sequences 1xlt_C 1xlt_F 1xlt_I 000099345|e1xltC1|2003.1.4.6|C:1-174 cath|current|1xltC00/291-464 cath|current|1xltF00/292-464 cath|current|1xltI00/292-464 1xltC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]