SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xmpA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xmpA
Domain Number 1 Region: 13-164
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 1.54e-101
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xmpA   PDB: 1xmp   SUPERFAMILY: 1xmpA
Sequence length 170
Comment (A:)
Sequence
gsshhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyae
tarerglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpv
atvaigkagstnagllaaqilgsfhddihdalelrreaiekdvregselv
Download sequence
Identical sequences cath|current|1xmpA00/2-156 cath|current|1xmpB00/2-158 cath|current|1xmpC00/-7-156 cath|current|1xmpD00/2-156 cath|current|1xmpE00/2-156 cath|current|1xmpF00/2-161 cath|current|1xmpG00/-7-156 cath|current|1xmpH00/2-161 1xmpA 1xmp_A 1xmp_B 1xmp_C 1xmp_D 1xmp_E 1xmp_F 1xmp_G 1xmp_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]