SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xngA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xngA
Domain Number 1 Region: 11-251
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.48e-86
Family N-type ATP pyrophosphatases 0.000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xngA   PDB: 1xng
Sequence length 268
Comment (A:)
Sequence
mqkdyqklivylcdflekevqkrgfkkvvyglsggldsavvgvlcqkvfkenahallmps
svsmpenktdalnlcekfsipyteysiapydaifsshfkdasltrkgnfcarlrmaflyd
yslksdslvigtsnksermlgygtlfgdlacainpigelfktevyelarrlnipkkilnk
ppsadlfvgqsdekdlgypysvidpllkdiealfqtkpidtetlaqlgydeilvknitsr
iqknafklelpaiakrfnpelehhhhhh
Download sequence
Identical sequences 1xngA 1xng_A 1xng_B 1xnh_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]