SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xouB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xouB
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily EspA/CesA-like 3.37e-46
Family EspA chaperone CesA 0.00000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xouB   PDB: 1xou   SUPERFAMILY: 1xouB
Sequence length 95
Comment (B:)
Sequence
mgivsqtrnkelldkkirseieaikkiiaefdvvkesvnelsekaktdpqaaeklnklie
gytygeerklydsalskieklietlsparsksqst
Download sequence
Identical sequences 1xou_B 1xouB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]