SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xpxA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xpxA
Domain Number 1 Region: 6-162
Classification Level Classification E-value
Superfamily Homeodomain-like 1.37e-149
Family Homeodomain 0.0000000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xpxA   PDB: 1xpx
Sequence length 163
Comment (A:)
Sequence
tplhsstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyy
iqmekyarqavtegiktpddlliagdselyrvlnlhynrnnhievpqnfrfvvestlref
fraiqggkdteqswkksiykiisrmddpvpeyfkspnfleqle
Download sequence
Identical sequences 1xpx_A 1xpxA cath|current|1xpxA00/1245-1401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]