SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xqhA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xqhA
Domain Number 1 Region: 92-251
Classification Level Classification E-value
Superfamily SET domain 1.89e-40
Family Histone lysine methyltransferases 0.0000000388
Further Details:      
 
Domain Number 2 Region: 5-65
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0000000000388
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xqhA   PDB: 1xqh
Sequence length 264
Comment (A:)
Sequence
gplgsgqykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidg
emiegklatlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaesl
issageglfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepyn
hvskycaslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhspp
gksgpeapewyqvelkafqatqqk
Download sequence
Identical sequences 1xqhA 1xqh_A 1xqh_E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]