SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xqoA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xqoA
Domain Number 1 Region: 5-252
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.95e-81
Family AgoG-like 0.000000000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xqoA   PDB: 1xqo   SUPERFAMILY: 1xqoA
Sequence length 256
Comment (A:)
Sequence
MAAESQLKRVIETLRRLGIEEVLKLERRDPQYRAVCNVVKRHGETVGSRLAMLNALISYR
LTGKGEEHWEYFGKYFSQLEVIDLCRDFLKYIETSPFLKIGVEARKKRALKACDYVPNLE
DLGLTLRQLSHIVGARREQKTLVFTIKILNYAYMCSRGVNRVLPFDIPIPVDYRVARLTW
CAGLIDFPPEEALRRYEAVQKIWDAVARETGIPPLHLDTLLWLAGRAVLYGENLHGVPKE
VIALFQWRGGCRPPSE
Download sequence
Identical sequences Q8ZVK6
178306.PAE2237 1xqo_A 1xqp_A gi|18313201|ref|NP_559868.1| 1xqoA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]