SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xtfA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xtfA
Domain Number 1 Region: 1-418
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.25e-158
Family Clostridium neurotoxins, catalytic domain 0.0000000000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xtfA   PDB: 1xtf   SUPERFAMILY: 1xtfA
Sequence length 427
Comment (A:)
Sequence
pfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnp
ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahqlihaghrlygiainpnr
vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
nrktflnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftp
ghhhhhh
Download sequence
Identical sequences 1xtfA cath|current|1xtfA00/2-428 cath|current|1xtfB00/430-856 1xtf_A 1xtf_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]