SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1y2iA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1y2iA
Domain Number 1 Region: 25-130
Classification Level Classification E-value
Superfamily YbjQ-like 1.39e-38
Family YbjQ-like 0.00000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1y2iA   PDB: 1y2i   SUPERFAMILY: 1y2iA
Sequence length 133
Comment (A:)
Sequence
mhhhhhhssgvdlgtenlyfqsnamqfsttptlegltiveycgvvtgeailganifrdff
agirdivggrsgayekelrkareiafeelgsqaralgadavvgididyetvgqngsmlmv
svsgtavktrrni
Download sequence
Identical sequences 1y2iA 1y2i_A 1y2i_B 1y2i_C 1y2i_D 1y2i_E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]