SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1y43A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1y43A
Domain Number 1 Region: 2-34
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000657
Family Peptidase A4 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1y43A   PDB: 1y43
Sequence length 39
Comment (A:)
Sequence
eeyssnwagavligdgytkvtgeftvpsvsagssgssgy
Download sequence
Identical sequences 1y43_A 3trs_A 3trs_C 1y43A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]