SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1y65A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1y65A
Domain Number 1 Region: 4-283
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.64e-116
Family NagZ-like 0.000000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1y65A   PDB: 1y65   SUPERFAMILY: 1y65A
Sequence length 342
Comment (A:)
Sequence
mslgplwldvagyelsaedreilqhptvggvilfgrnyhdnqqllalnkairqaakrpil
igvdqeggrvqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvl
dmgfackaignrafgedvqtvlkhssaflrgmkavgmattgkhfpghgaviadshletpy
deretiaqdmaifraqieagvldammpahvvyphydaqpasgssywlkqvlreelgfkgi
vfsddlsmegaavmggpvershqalvagcdmilicnkreaavevldnlpimevpqaeall
kkqqfsyselkrlerwqqasanmqrlieqfseeggshhhhhh
Download sequence
Identical sequences 1y65A NYSGXRC-T1608 cath|current|1y65A00/0-329 1y65_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]