SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1y6dA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1y6dA
Domain Number 1 Region: 8-118
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 6.52e-25
Family Phosphorelay protein luxU 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1y6dA   PDB: 1y6d   SUPERFAMILY: 1y6dA
Sequence length 120
Comment (A:)
Sequence
hhhhhhmntdvlnqqkieelsaeigsdnvpvlldiflgemdsyigtltelqgseqllylk
eishalkssaasfgadrlceraiaidkkakanqlqeqgmetsemlallhitrdayrswtn
Download sequence
Identical sequences 1y6d_A cath|current|1y6dA00/1-114 1y6dA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]