SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1yb0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1yb0A
Domain Number 1 Region: 4-155
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 6.3e-53
Family N-acetylmuramoyl-L-alanine amidase-like 0.000000963
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1yb0A   PDB: 1yb0
Sequence length 159
Comment (A:)
Sequence
meirkklvvpskygtkcpytmkpkyitvhntyndapaenevnymitnnnevsfhvavddk
qaiqgipwernawacgdgngpgnresisveicysksggdryykaennavdvvrqlmsmyn
ipienvrthqswsgkycphrmlaegrwgafiqkvksgnv
Download sequence
Identical sequences 1yb0A 1yb0_A 1yb0_B 1yb0_C 001903978|e1yb0B1|285.1.1.1|B:1-159 cath|current|1yb0A00/1-157 cath|current|1yb0B00/1-159 cath|current|1yb0C00/1-157 d1yb0b_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]