SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1yc5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1yc5A
Domain Number 1 Region: 5-242
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 8.23e-112
Family Sir2 family of transcriptional regulators 0.000000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1yc5A   PDB: 1yc5
Sequence length 246
Comment (A:)
Sequence
MKMKEFLDLLNESRLTVTLTGAGISTPSGIPDFRGPNGIYKKYSQNVFDIDFFYSHPEEF
YRFAKEGIFPMLQAKPNLAHVLLAKLEEKGLIEAVITQNIDRLHQRAGSKKVIELHGNVE
EYYCVRCEKKYTVEDVIKKLESSDVPLCDDCNSLIRPNIVFFGENLPQDALREAIGLSSR
ASLMIVLGSSLVVYPAAELPLITVRSGGKLVIVNLGETPFDDIATLKYNMDVVEFARRVM
EEGGIS
Download sequence
Identical sequences Q9WYW0
1yc5_A 2h2d_A 2h2f_A 2h2g_A 2h2h_A 2h2i_A 2h4f_A 2h4j_A 3d4b_A 3d81_A 3pdh_A 4buz_A 4bv2_A 4bv2_B gi|15643256|ref|NP_228300.1| gi|15643256|ref|NP_228300.1| 1yc5A d2h2da_ d2h2fa_ d2h2ha_ d2h4fa_ d2h4ja_ d3d81a_ d3pdha_ NP_228300.1.35502 WP_010865133.1.29620 WP_010865133.1.45724 WP_010865133.1.51363 WP_010865133.1.56403 WP_010865133.1.79805 243274.TM0490 282363 APC4231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]