SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ycnA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ycnA
Domain Number 1 Region: 13-313
Classification Level Classification E-value
Superfamily Annexin 5.27e-147
Family Annexin 0.000000000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ycnA   PDB: 1ycn   SUPERFAMILY: 1ycnA
Sequence length 317
Comment (A:)
Sequence
satlkvsdsvpapsddaeqlrtafegwgtnedliisilahrsaeqrkvirqayhetyged
llktldkelsndferaillwtlepgerdallaneatkrwtssnqvlmevactrtstqllh
arqayharykksleedvahhttgdfrkllvslvtsyryegdevnmtlakqeaklvhekik
dkhyndedvirilstrskaqinatfnryqddhgeeilksleegddddkflallrstiqcl
trpelyfvdvlrsainktgtdegaltrivttraeidlkvigeeyqrrnsiplekaitkdt
rgdyekmlvallgedda
Download sequence
Identical sequences 1ycnA 1ycn_A 1ycn_B 2q4c_A 2q4c_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]