SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ynoA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ynoA
Domain Number 1 Region: 182-340
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 8.35e-62
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000000891
Further Details:      
 
Domain Number 2 Region: 351-522
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.06e-51
Family Pyruvate oxidase and decarboxylase PP module 0.0000000477
Further Details:      
 
Domain Number 3 Region: 6-171
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.47e-40
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ynoA   PDB: 1yno
Sequence length 527
Comment (A:)
Sequence
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
viavigdgsanysisalwtaaqyniptifvimnngtygalrwfagvleaenvpgldvpgi
dfralakgygvqalkadnleqlkgslqealsakgpvlievstvspvk
Download sequence
Identical sequences 1ynoA 1yno_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]