SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1yrgA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1yrgA
Domain Number 1 Region: 15-319
Classification Level Classification E-value
Superfamily RNI-like 1.32e-58
Family Rna1p (RanGAP1), N-terminal domain 0.0000000000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1yrgA   PDB: 1yrg   SUPERFAMILY: 1yrgA
Sequence length 385
Comment (A:)
Sequence
arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmeeltdeeeedeeeeaesq
spepetseeekedkeladelskahi
Download sequence
Identical sequences 1yrg_A 1yrg_B 1yrgA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]