SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1yrnA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1yrnA
Domain Number 1 Region: 4-61
Classification Level Classification E-value
Superfamily Homeodomain-like 3.92e-16
Family Homeodomain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1yrnA   PDB: 1yrn   SUPERFAMILY: 1yrnA
Sequence length 61
Comment (A:)
Sequence
kkekspkgkssispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrs
k
Download sequence
Identical sequences 1yrnA 1f43_A 1yrn_A cath|current|1f43A00/-3-57 cath|current|1yrnA00/77-125 d1f43a_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]