SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1yrrA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1yrrA
Domain Number 1 Region: 54-350
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 2.01e-101
Family N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain 0.0000000000377
Further Details:      
 
Domain Number 2 Region: 1-53
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 3.76e-18
Family N-acetylglucosamine-6-phosphate deacetylase, NagA 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1yrrA   PDB: 1yrr
Sequence length 382
Comment (A:)
Sequence
MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQL
NGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAK
HPNQALGLHLEGPWLNLVKKGTHNPNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEV
ISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEAD
IYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCV
DENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANL
TAFTPDFKITKTIVNGNEVVTQ
Download sequence
Identical sequences A0A023YTK0 A0A025CLL8 A0A026V4S3 A0A027TFP6 A0A028A2S6 A0A028DLR8 A0A062Y3F5 A0A069XKP8 A0A070F6Z9 A0A070SII4 A0A073GC28 A0A073HQ63 A0A073ULS0 A0A0A8U4L8 A0A0F6C0H9 A0A0F6F2M0 A0A0H3PSJ3 A0A0M7P7R4 A0A1S6T8J8 A0A1X3J580 A0A1X3JKU6 A0A1X3L6D3 A0A1Z3UTF6 A0A2A2XL23 A0A2H1BMY0 A7ZJ59 C3TJ32 C8U328 C8UJY2 D3QLV6 D6I6Q3 D7XXD1 E0J1S9 E1J1I0 E6BKY0 E9XNZ0 E9YRN2 F4NLR7 F4SKN1 F4TBN6 F4VB93 G0FEF2 H4UFZ5 I2RBC6 I2UK83 I2W5C0 I2WSB0 I2X7X9 J7QJQ7 K4V8Z2 K4XJ85 L3BRD5 L4VYX1 M9GCW0 P0AF18 P0AF19 U9XSW2 V6FS73 V8FKA4 W0FQ15 W1EUL3 W1X2W9
gi|260853917|ref|YP_003227808.1| gi|386708448|ref|YP_006172169.1| gi|16128653|ref|NP_415203.1| gi|15800379|ref|NP_286391.1| gi|387620409|ref|YP_006128036.1| gi|260866814|ref|YP_003233216.1| gi|157156004|ref|YP_001461838.1| gi|238899943|ref|YP_002925739.1| gi|388476769|ref|YP_488957.1| gi|260842892|ref|YP_003220670.1| NYSGXRC-T2187 gi|387620409|ref|YP_006128036.1| gi|378713955|ref|YP_005278848.1| NP_308734.1.58667 NP_415203.1.90541 WP_000271153.1.10001 WP_000271153.1.100044 WP_000271153.1.100073 WP_000271153.1.100085 WP_000271153.1.10010 WP_000271153.1.100111 WP_000271153.1.100283 WP_000271153.1.100299 WP_000271153.1.100302 WP_000271153.1.100425 WP_000271153.1.100441 WP_000271153.1.100508 WP_000271153.1.10051 WP_000271153.1.100531 WP_000271153.1.100543 WP_000271153.1.100554 WP_000271153.1.100571 WP_000271153.1.100667 WP_000271153.1.100689 WP_000271153.1.100718 WP_000271153.1.100796 WP_000271153.1.100803 WP_000271153.1.100824 WP_000271153.1.100836 WP_000271153.1.100867 WP_000271153.1.100925 WP_000271153.1.100990 WP_000271153.1.101033 WP_000271153.1.101105 WP_000271153.1.101157 WP_000271153.1.101158 WP_000271153.1.101166 WP_000271153.1.101186 WP_000271153.1.101206 WP_000271153.1.101216 WP_000271153.1.101257 WP_000271153.1.10126 WP_000271153.1.101289 WP_000271153.1.101293 WP_000271153.1.101423 WP_000271153.1.101436 WP_000271153.1.101468 WP_000271153.1.10154 WP_000271153.1.101583 WP_000271153.1.101628 WP_000271153.1.101630 WP_000271153.1.101651 WP_000271153.1.101653 WP_000271153.1.101654 WP_000271153.1.101668 WP_000271153.1.101737 WP_000271153.1.101747 WP_000271153.1.101786 WP_000271153.1.101840 WP_000271153.1.101865 WP_000271153.1.10188 WP_000271153.1.101900 WP_000271153.1.101913 WP_000271153.1.101952 WP_000271153.1.101962 WP_000271153.1.10206 WP_000271153.1.102069 WP_000271153.1.102094 WP_000271153.1.102122 WP_000271153.1.102139 WP_000271153.1.10252 WP_000271153.1.10273 WP_000271153.1.10335 WP_000271153.1.10379 WP_000271153.1.10381 WP_000271153.1.10400 WP_000271153.1.10417 WP_000271153.1.10476 WP_000271153.1.10491 WP_000271153.1.10524 WP_000271153.1.10579 WP_000271153.1.10607 WP_000271153.1.10673 WP_000271153.1.1071 WP_000271153.1.10729 WP_000271153.1.1073 WP_000271153.1.1074 WP_000271153.1.10761 WP_000271153.1.10763 WP_000271153.1.10798 WP_000271153.1.10824 WP_000271153.1.10833 WP_000271153.1.10922 WP_000271153.1.10970 WP_000271153.1.10988 WP_000271153.1.11047 WP_000271153.1.11052 WP_000271153.1.11068 WP_000271153.1.11071 WP_000271153.1.11091 WP_000271153.1.1111 WP_000271153.1.11118 WP_000271153.1.11121 WP_000271153.1.1113 WP_000271153.1.1122 WP_000271153.1.11240 WP_000271153.1.11301 WP_000271153.1.11420 WP_000271153.1.11542 WP_000271153.1.11578 WP_000271153.1.11616 WP_000271153.1.11671 WP_000271153.1.11690 WP_000271153.1.11748 WP_000271153.1.11759 WP_000271153.1.11801 WP_000271153.1.11949 WP_000271153.1.11955 WP_000271153.1.11985 WP_000271153.1.12030 WP_000271153.1.12051 WP_000271153.1.1212 WP_000271153.1.12259 WP_000271153.1.12279 WP_000271153.1.12305 WP_000271153.1.12320 WP_000271153.1.12342 WP_000271153.1.12352 WP_000271153.1.12458 WP_000271153.1.12478 WP_000271153.1.12542 WP_000271153.1.12552 WP_000271153.1.12582 WP_000271153.1.12645 WP_000271153.1.12646 WP_000271153.1.12693 WP_000271153.1.127 WP_000271153.1.12717 WP_000271153.1.12743 WP_000271153.1.12749 WP_000271153.1.1275 WP_000271153.1.12756 WP_000271153.1.12762 WP_000271153.1.12766 WP_000271153.1.12781 WP_000271153.1.12831 WP_000271153.1.12876 WP_000271153.1.1295 WP_000271153.1.13015 WP_000271153.1.13031 WP_000271153.1.13060 WP_000271153.1.1312 WP_000271153.1.13136 WP_000271153.1.13162 WP_000271153.1.13176 WP_000271153.1.13217 WP_000271153.1.13222 WP_000271153.1.13223 WP_000271153.1.13239 WP_000271153.1.13258 WP_000271153.1.13278 WP_000271153.1.13281 WP_000271153.1.13290 WP_000271153.1.13332 WP_000271153.1.13333 WP_000271153.1.13348 WP_000271153.1.1335 WP_000271153.1.13430 WP_000271153.1.13437 WP_000271153.1.13442 WP_000271153.1.13481 WP_000271153.1.13495 WP_000271153.1.13525 WP_000271153.1.13585 WP_000271153.1.13618 WP_000271153.1.13624 WP_000271153.1.13656 WP_000271153.1.13881 WP_000271153.1.13924 WP_000271153.1.13936 WP_000271153.1.13939 WP_000271153.1.13944 WP_000271153.1.13949 WP_000271153.1.14030 WP_000271153.1.14058 WP_000271153.1.14062 WP_000271153.1.14070 WP_000271153.1.14110 WP_000271153.1.1419 WP_000271153.1.14304 WP_000271153.1.1439 WP_000271153.1.14398 WP_000271153.1.14417 WP_000271153.1.14432 WP_000271153.1.14453 WP_000271153.1.14493 WP_000271153.1.14501 WP_000271153.1.14508 WP_000271153.1.14529 WP_000271153.1.14582 WP_000271153.1.14601 WP_000271153.1.1461 WP_000271153.1.14621 WP_000271153.1.14672 WP_000271153.1.14678 WP_000271153.1.14687 WP_000271153.1.14693 WP_000271153.1.14811 WP_000271153.1.14833 WP_000271153.1.14879 WP_000271153.1.14956 WP_000271153.1.14977 WP_000271153.1.14993 WP_000271153.1.15087 WP_000271153.1.1510 WP_000271153.1.1512 WP_000271153.1.15138 WP_000271153.1.15193 WP_000271153.1.15221 WP_000271153.1.1524 WP_000271153.1.15259 WP_000271153.1.15270 WP_000271153.1.15282 WP_000271153.1.15300 WP_000271153.1.15332 WP_000271153.1.15335 WP_000271153.1.15356 WP_000271153.1.15416 WP_000271153.1.1543 WP_000271153.1.15453 WP_000271153.1.15469 WP_000271153.1.15503 WP_000271153.1.15527 WP_000271153.1.15528 WP_000271153.1.1559 WP_000271153.1.15593 WP_000271153.1.15600 WP_000271153.1.1561 WP_000271153.1.15620 WP_000271153.1.15626 WP_000271153.1.15645 WP_000271153.1.15702 WP_000271153.1.15731 WP_000271153.1.15747 WP_000271153.1.15752 WP_000271153.1.15782 WP_000271153.1.15791 WP_000271153.1.1582 WP_000271153.1.1588 WP_000271153.1.15916 WP_000271153.1.15983 WP_000271153.1.16014 WP_000271153.1.16075 WP_000271153.1.16086 WP_000271153.1.1609 WP_000271153.1.16133 WP_000271153.1.16154 WP_000271153.1.1621 WP_000271153.1.16222 WP_000271153.1.16270 WP_000271153.1.16272 WP_000271153.1.16294 WP_000271153.1.163 WP_000271153.1.16322 WP_000271153.1.16387 WP_000271153.1.1640 WP_000271153.1.16463 WP_000271153.1.16481 WP_000271153.1.16517 WP_000271153.1.16532 WP_000271153.1.16539 WP_000271153.1.16577 WP_000271153.1.16592 WP_000271153.1.16721 WP_000271153.1.16805 WP_000271153.1.16845 WP_000271153.1.16861 WP_000271153.1.16992 WP_000271153.1.17018 WP_000271153.1.17084 WP_000271153.1.17087 WP_000271153.1.1710 WP_000271153.1.17102 WP_000271153.1.17109 WP_000271153.1.17111 WP_000271153.1.17114 WP_000271153.1.17170 WP_000271153.1.17187 WP_000271153.1.17242 WP_000271153.1.17267 WP_000271153.1.17297 WP_000271153.1.1731 WP_000271153.1.17333 WP_000271153.1.17356 WP_000271153.1.17373 WP_000271153.1.17386 WP_000271153.1.17392 WP_000271153.1.17415 WP_000271153.1.17417 WP_000271153.1.17432 WP_000271153.1.17464 WP_000271153.1.17515 WP_000271153.1.1755 WP_000271153.1.17577 WP_000271153.1.17623 WP_000271153.1.17637 WP_000271153.1.1769 WP_000271153.1.17701 WP_000271153.1.17829 WP_000271153.1.17904 WP_000271153.1.17920 WP_000271153.1.17963 WP_000271153.1.17984 WP_000271153.1.18000 WP_000271153.1.18006 WP_000271153.1.18064 WP_000271153.1.18094 WP_000271153.1.18112 WP_000271153.1.18136 WP_000271153.1.18175 WP_000271153.1.18275 WP_000271153.1.18326 WP_000271153.1.18338 WP_000271153.1.1834 WP_000271153.1.18340 WP_000271153.1.18381 WP_000271153.1.18402 WP_000271153.1.18410 WP_000271153.1.18436 WP_000271153.1.18438 WP_000271153.1.18458 WP_000271153.1.18530 WP_000271153.1.18550 WP_000271153.1.18588 WP_000271153.1.18649 WP_000271153.1.18650 WP_000271153.1.188 WP_000271153.1.1881 WP_000271153.1.18837 WP_000271153.1.18861 WP_000271153.1.18874 WP_000271153.1.18899 WP_000271153.1.18923 WP_000271153.1.18936 WP_000271153.1.18966 WP_000271153.1.18995 WP_000271153.1.19039 WP_000271153.1.1906 WP_000271153.1.1909 WP_000271153.1.191 WP_000271153.1.19100 WP_000271153.1.19114 WP_000271153.1.19140 WP_000271153.1.19150 WP_000271153.1.19194 WP_000271153.1.19277 WP_000271153.1.19297 WP_000271153.1.193 WP_000271153.1.19313 WP_000271153.1.19332 WP_000271153.1.19347 WP_000271153.1.19350 WP_000271153.1.19389 WP_000271153.1.19397 WP_000271153.1.19419 WP_000271153.1.19424 WP_000271153.1.19478 WP_000271153.1.19494 WP_000271153.1.19583 WP_000271153.1.1963 WP_000271153.1.19778 WP_000271153.1.1982 WP_000271153.1.19840 WP_000271153.1.19847 WP_000271153.1.19889 WP_000271153.1.19940 WP_000271153.1.19957 WP_000271153.1.2005 WP_000271153.1.20114 WP_000271153.1.20129 WP_000271153.1.20251 WP_000271153.1.20264 WP_000271153.1.20325 WP_000271153.1.20334 WP_000271153.1.20449 WP_000271153.1.20480 WP_000271153.1.20536 WP_000271153.1.20546 WP_000271153.1.20549 WP_000271153.1.20594 WP_000271153.1.20596 WP_000271153.1.20609 WP_000271153.1.2063 WP_000271153.1.20638 WP_000271153.1.20662 WP_000271153.1.20730 WP_000271153.1.20737 WP_000271153.1.20745 WP_000271153.1.20765 WP_000271153.1.20785 WP_000271153.1.20824 WP_000271153.1.20848 WP_000271153.1.20893 WP_000271153.1.20941 WP_000271153.1.20950 WP_000271153.1.20982 WP_000271153.1.20989 WP_000271153.1.2100 WP_000271153.1.21033 WP_000271153.1.21041 WP_000271153.1.21057 WP_000271153.1.21122 WP_000271153.1.21137 WP_000271153.1.21336 WP_000271153.1.21508 WP_000271153.1.21519 WP_000271153.1.21573 WP_000271153.1.21596 WP_000271153.1.21628 WP_000271153.1.2164 WP_000271153.1.21666 WP_000271153.1.21667 WP_000271153.1.21668 WP_000271153.1.21696 WP_000271153.1.21732 WP_000271153.1.21756 WP_000271153.1.21771 WP_000271153.1.21812 WP_000271153.1.21823 WP_000271153.1.21915 WP_000271153.1.21945 WP_000271153.1.21948 WP_000271153.1.21962 WP_000271153.1.21986 WP_000271153.1.22060 WP_000271153.1.22113 WP_000271153.1.22138 WP_000271153.1.2218 WP_000271153.1.22251 WP_000271153.1.22291 WP_000271153.1.22304 WP_000271153.1.22314 WP_000271153.1.22325 WP_000271153.1.22363 WP_000271153.1.22381 WP_000271153.1.22494 WP_000271153.1.22544 WP_000271153.1.22594 WP_000271153.1.22631 WP_000271153.1.22632 WP_000271153.1.22662 WP_000271153.1.22669 WP_000271153.1.22690 WP_000271153.1.22756 WP_000271153.1.22759 WP_000271153.1.22830 WP_000271153.1.22868 WP_000271153.1.22875 WP_000271153.1.22878 WP_000271153.1.22885 WP_000271153.1.22925 WP_000271153.1.23005 WP_000271153.1.23026 WP_000271153.1.23035 WP_000271153.1.23044 WP_000271153.1.23073 WP_000271153.1.23078 WP_000271153.1.23090 WP_000271153.1.23105 WP_000271153.1.23115 WP_000271153.1.23135 WP_000271153.1.23241 WP_000271153.1.23285 WP_000271153.1.23290 WP_000271153.1.23299 WP_000271153.1.23323 WP_000271153.1.23355 WP_000271153.1.23378 WP_000271153.1.23383 WP_000271153.1.23463 WP_000271153.1.23467 WP_000271153.1.23487 WP_000271153.1.23511 WP_000271153.1.23520 WP_000271153.1.23527 WP_000271153.1.23593 WP_000271153.1.23693 WP_000271153.1.23754 WP_000271153.1.23765 WP_000271153.1.23790 WP_000271153.1.23806 WP_000271153.1.23838 WP_000271153.1.23855 WP_000271153.1.2388 WP_000271153.1.23895 WP_000271153.1.23899 WP_000271153.1.23915 WP_000271153.1.23945 WP_000271153.1.23960 WP_000271153.1.23973 WP_000271153.1.23984 WP_000271153.1.24024 WP_000271153.1.24068 WP_000271153.1.24070 WP_000271153.1.24124 WP_000271153.1.2428 WP_000271153.1.24283 WP_000271153.1.2430 WP_000271153.1.24341 WP_000271153.1.24362 WP_000271153.1.24374 WP_000271153.1.24381 WP_000271153.1.24458 WP_000271153.1.24460 WP_000271153.1.24485 WP_000271153.1.24616 WP_000271153.1.24634 WP_000271153.1.24641 WP_000271153.1.24642 WP_000271153.1.24646 WP_000271153.1.24650 WP_000271153.1.24693 WP_000271153.1.24753 WP_000271153.1.2479 WP_000271153.1.24854 WP_000271153.1.24870 WP_000271153.1.24899 WP_000271153.1.24929 WP_000271153.1.24939 WP_000271153.1.24946 WP_000271153.1.24984 WP_000271153.1.25019 WP_000271153.1.2504 WP_000271153.1.25076 WP_000271153.1.25082 WP_000271153.1.25086 WP_000271153.1.25088 WP_000271153.1.25141 WP_000271153.1.25201 WP_000271153.1.25305 WP_000271153.1.25324 WP_000271153.1.25378 WP_000271153.1.25414 WP_000271153.1.2543 WP_000271153.1.25525 WP_000271153.1.25526 WP_000271153.1.25548 WP_000271153.1.25577 WP_000271153.1.2558 WP_000271153.1.25592 WP_000271153.1.25613 WP_000271153.1.25631 WP_000271153.1.25713 WP_000271153.1.25724 WP_000271153.1.25726 WP_000271153.1.25794 WP_000271153.1.25819 WP_000271153.1.25831 WP_000271153.1.25886 WP_000271153.1.26048 WP_000271153.1.26061 WP_000271153.1.26066 WP_000271153.1.26100 WP_000271153.1.26105 WP_000271153.1.26121 WP_000271153.1.26134 WP_000271153.1.26161 WP_000271153.1.26186 WP_000271153.1.26246 WP_000271153.1.26264 WP_000271153.1.26331 WP_000271153.1.26401 WP_000271153.1.26419 WP_000271153.1.26438 WP_000271153.1.26474 WP_000271153.1.26479 WP_000271153.1.26480 WP_000271153.1.26525 WP_000271153.1.26569 WP_000271153.1.26590 WP_000271153.1.26598 WP_000271153.1.26609 WP_000271153.1.26644 WP_000271153.1.26658 WP_000271153.1.26716 WP_000271153.1.26720 WP_000271153.1.26761 WP_000271153.1.26878 WP_000271153.1.26975 WP_000271153.1.26998 WP_000271153.1.27019 WP_000271153.1.27101 WP_000271153.1.27134 WP_000271153.1.27141 WP_000271153.1.27148 WP_000271153.1.27175 WP_000271153.1.27234 WP_000271153.1.27260 WP_000271153.1.27280 WP_000271153.1.27283 WP_000271153.1.2731 WP_000271153.1.27310 WP_000271153.1.27330 WP_000271153.1.27338 WP_000271153.1.27367 WP_000271153.1.27373 WP_000271153.1.27424 WP_000271153.1.27445 WP_000271153.1.27451 WP_000271153.1.27504 WP_000271153.1.27518 WP_000271153.1.27524 WP_000271153.1.27580 WP_000271153.1.27585 WP_000271153.1.27698 WP_000271153.1.27723 WP_000271153.1.27741 WP_000271153.1.27742 WP_000271153.1.27758 WP_000271153.1.27879 WP_000271153.1.27897 WP_000271153.1.27923 WP_000271153.1.28110 WP_000271153.1.28143 WP_000271153.1.2826 WP_000271153.1.28271 WP_000271153.1.28305 WP_000271153.1.28318 WP_000271153.1.28401 WP_000271153.1.28480 WP_000271153.1.28496 WP_000271153.1.28509 WP_000271153.1.28551 WP_000271153.1.28554 WP_000271153.1.28662 WP_000271153.1.28697 WP_000271153.1.28711 WP_000271153.1.28734 WP_000271153.1.28879 WP_000271153.1.28919 WP_000271153.1.28953 WP_000271153.1.28994 WP_000271153.1.29001 WP_000271153.1.29061 WP_000271153.1.29082 WP_000271153.1.291 WP_000271153.1.29125 WP_000271153.1.29126 WP_000271153.1.29150 WP_000271153.1.29176 WP_000271153.1.29194 WP_000271153.1.29202 WP_000271153.1.29404 WP_000271153.1.29429 WP_000271153.1.29503 WP_000271153.1.29504 WP_000271153.1.2954 WP_000271153.1.29564 WP_000271153.1.29590 WP_000271153.1.29597 WP_000271153.1.29618 WP_000271153.1.29669 WP_000271153.1.29683 WP_000271153.1.29715 WP_000271153.1.29724 WP_000271153.1.29746 WP_000271153.1.29752 WP_000271153.1.2978 WP_000271153.1.29798 WP_000271153.1.29818 WP_000271153.1.29840 WP_000271153.1.29874 WP_000271153.1.29876 WP_000271153.1.29976 WP_000271153.1.29992 WP_000271153.1.30 WP_000271153.1.30019 WP_000271153.1.30035 WP_000271153.1.30052 WP_000271153.1.30064 WP_000271153.1.30098 WP_000271153.1.30105 WP_000271153.1.30164 WP_000271153.1.30231 WP_000271153.1.30253 WP_000271153.1.30399 WP_000271153.1.30428 WP_000271153.1.30476 WP_000271153.1.30497 WP_000271153.1.30554 WP_000271153.1.30630 WP_000271153.1.30637 WP_000271153.1.30733 WP_000271153.1.30749 WP_000271153.1.30843 WP_000271153.1.30853 WP_000271153.1.30906 WP_000271153.1.30918 WP_000271153.1.30993 WP_000271153.1.30999 WP_000271153.1.31009 WP_000271153.1.31055 WP_000271153.1.312 WP_000271153.1.31211 WP_000271153.1.31252 WP_000271153.1.31319 WP_000271153.1.31340 WP_000271153.1.31347 WP_000271153.1.31357 WP_000271153.1.31379 WP_000271153.1.3140 WP_000271153.1.31401 WP_000271153.1.31407 WP_000271153.1.31429 WP_000271153.1.31518 WP_000271153.1.31521 WP_000271153.1.31575 WP_000271153.1.3169 WP_000271153.1.31715 WP_000271153.1.31740 WP_000271153.1.31803 WP_000271153.1.31833 WP_000271153.1.31839 WP_000271153.1.31866 WP_000271153.1.31924 WP_000271153.1.3193 WP_000271153.1.31956 WP_000271153.1.31978 WP_000271153.1.32063 WP_000271153.1.32121 WP_000271153.1.32138 WP_000271153.1.32142 WP_000271153.1.32143 WP_000271153.1.3215 WP_000271153.1.32184 WP_000271153.1.322 WP_000271153.1.32232 WP_000271153.1.32243 WP_000271153.1.32287 WP_000271153.1.3233 WP_000271153.1.32406 WP_000271153.1.3247 WP_000271153.1.32475 WP_000271153.1.32479 WP_000271153.1.32494 WP_000271153.1.32536 WP_000271153.1.32574 WP_000271153.1.32590 WP_000271153.1.32591 WP_000271153.1.32811 WP_000271153.1.32875 WP_000271153.1.32888 WP_000271153.1.32903 WP_000271153.1.32910 WP_000271153.1.32931 WP_000271153.1.3295 WP_000271153.1.32984 WP_000271153.1.32995 WP_000271153.1.33014 WP_000271153.1.33018 WP_000271153.1.33049 WP_000271153.1.33055 WP_000271153.1.33094 WP_000271153.1.33125 WP_000271153.1.33146 WP_000271153.1.33178 WP_000271153.1.33268 WP_000271153.1.334 WP_000271153.1.33424 WP_000271153.1.33475 WP_000271153.1.33476 WP_000271153.1.33512 WP_000271153.1.3354 WP_000271153.1.33565 WP_000271153.1.33638 WP_000271153.1.33680 WP_000271153.1.33799 WP_000271153.1.33823 WP_000271153.1.33853 WP_000271153.1.33854 WP_000271153.1.33896 WP_000271153.1.33914 WP_000271153.1.33948 WP_000271153.1.3398 WP_000271153.1.33981 WP_000271153.1.3401 WP_000271153.1.3411 WP_000271153.1.34122 WP_000271153.1.34124 WP_000271153.1.34204 WP_000271153.1.34206 WP_000271153.1.34224 WP_000271153.1.34269 WP_000271153.1.34363 WP_000271153.1.34383 WP_000271153.1.3439 WP_000271153.1.34464 WP_000271153.1.34500 WP_000271153.1.34525 WP_000271153.1.34532 WP_000271153.1.34605 WP_000271153.1.34680 WP_000271153.1.34686 WP_000271153.1.3472 WP_000271153.1.34781 WP_000271153.1.34782 WP_000271153.1.34794 WP_000271153.1.34948 WP_000271153.1.34990 WP_000271153.1.34993 WP_000271153.1.3515 WP_000271153.1.35220 WP_000271153.1.35316 WP_000271153.1.35360 WP_000271153.1.35376 WP_000271153.1.3539 WP_000271153.1.35393 WP_000271153.1.35464 WP_000271153.1.35468 WP_000271153.1.3550 WP_000271153.1.35581 WP_000271153.1.3560 WP_000271153.1.35653 WP_000271153.1.35922 WP_000271153.1.35927 WP_000271153.1.35934 WP_000271153.1.35942 WP_000271153.1.35990 WP_000271153.1.36010 WP_000271153.1.36071 WP_000271153.1.36085 WP_000271153.1.36164 WP_000271153.1.36166 WP_000271153.1.36177 WP_000271153.1.36182 WP_000271153.1.3620 WP_000271153.1.36207 WP_000271153.1.36212 WP_000271153.1.36386 WP_000271153.1.36426 WP_000271153.1.36453 WP_000271153.1.36507 WP_000271153.1.36523 WP_000271153.1.36626 WP_000271153.1.36707 WP_000271153.1.36746 WP_000271153.1.36767 WP_000271153.1.36806 WP_000271153.1.36826 WP_000271153.1.36925 WP_000271153.1.37020 WP_000271153.1.37046 WP_000271153.1.37102 WP_000271153.1.37206 WP_000271153.1.37233 WP_000271153.1.37252 WP_000271153.1.37261 WP_000271153.1.37290 WP_000271153.1.37329 WP_000271153.1.37337 WP_000271153.1.37352 WP_000271153.1.37371 WP_000271153.1.37372 WP_000271153.1.37445 WP_000271153.1.37472 WP_000271153.1.37476 WP_000271153.1.37485 WP_000271153.1.37510 WP_000271153.1.37538 WP_000271153.1.37548 WP_000271153.1.37576 WP_000271153.1.37588 WP_000271153.1.3762 WP_000271153.1.37634 WP_000271153.1.377 WP_000271153.1.3772 WP_000271153.1.37731 WP_000271153.1.37758 WP_000271153.1.37762 WP_000271153.1.37766 WP_000271153.1.37769 WP_000271153.1.37852 WP_000271153.1.37880 WP_000271153.1.37917 WP_000271153.1.3795 WP_000271153.1.37964 WP_000271153.1.37995 WP_000271153.1.38033 WP_000271153.1.38050 WP_000271153.1.38063 WP_000271153.1.38081 WP_000271153.1.38103 WP_000271153.1.38105 WP_000271153.1.38107 WP_000271153.1.3811 WP_000271153.1.38182 WP_000271153.1.3822 WP_000271153.1.38306 WP_000271153.1.38314 WP_000271153.1.38369 WP_000271153.1.38412 WP_000271153.1.38485 WP_000271153.1.38584 WP_000271153.1.38626 WP_000271153.1.38629 WP_000271153.1.38636 WP_000271153.1.38694 WP_000271153.1.38722 WP_000271153.1.3873 WP_000271153.1.38751 WP_000271153.1.38777 WP_000271153.1.38811 WP_000271153.1.38835 WP_000271153.1.38896 WP_000271153.1.389 WP_000271153.1.38911 WP_000271153.1.38920 WP_000271153.1.38935 WP_000271153.1.38950 WP_000271153.1.38956 WP_000271153.1.38958 WP_000271153.1.39005 WP_000271153.1.39037 WP_000271153.1.3904 WP_000271153.1.39042 WP_000271153.1.39103 WP_000271153.1.39123 WP_000271153.1.39148 WP_000271153.1.39164 WP_000271153.1.39180 WP_000271153.1.39249 WP_000271153.1.39268 WP_000271153.1.39302 WP_000271153.1.39305 WP_000271153.1.39310 WP_000271153.1.39342 WP_000271153.1.39356 WP_000271153.1.39365 WP_000271153.1.39415 WP_000271153.1.39509 WP_000271153.1.3954 WP_000271153.1.39564 WP_000271153.1.39601 WP_000271153.1.39606 WP_000271153.1.39610 WP_000271153.1.39636 WP_000271153.1.39646 WP_000271153.1.3970 WP_000271153.1.39733 WP_000271153.1.39780 WP_000271153.1.39796 WP_000271153.1.39820 WP_000271153.1.39822 WP_000271153.1.39829 WP_000271153.1.39870 WP_000271153.1.39938 WP_000271153.1.39961 WP_000271153.1.40013 WP_000271153.1.40016 WP_000271153.1.40088 WP_000271153.1.40113 WP_000271153.1.40140 WP_000271153.1.40147 WP_000271153.1.40192 WP_000271153.1.4020 WP_000271153.1.40206 WP_000271153.1.40212 WP_000271153.1.40218 WP_000271153.1.40234 WP_000271153.1.40238 WP_000271153.1.40249 WP_000271153.1.4030 WP_000271153.1.40317 WP_000271153.1.40319 WP_000271153.1.40335 WP_000271153.1.40382 WP_000271153.1.40389 WP_000271153.1.40445 WP_000271153.1.40499 WP_000271153.1.40502 WP_000271153.1.40524 WP_000271153.1.40548 WP_000271153.1.40549 WP_000271153.1.40596 WP_000271153.1.40599 WP_000271153.1.406 WP_000271153.1.40617 WP_000271153.1.40629 WP_000271153.1.40686 WP_000271153.1.40742 WP_000271153.1.40758 WP_000271153.1.40781 WP_000271153.1.40793 WP_000271153.1.40813 WP_000271153.1.40815 WP_000271153.1.4082 WP_000271153.1.40882 WP_000271153.1.40898 WP_000271153.1.40900 WP_000271153.1.40912 WP_000271153.1.40952 WP_000271153.1.40965 WP_000271153.1.4103 WP_000271153.1.41037 WP_000271153.1.41060 WP_000271153.1.41125 WP_000271153.1.41206 WP_000271153.1.41239 WP_000271153.1.41287 WP_000271153.1.41294 WP_000271153.1.41330 WP_000271153.1.41371 WP_000271153.1.41392 WP_000271153.1.41394 WP_000271153.1.41401 WP_000271153.1.41402 WP_000271153.1.41417 WP_000271153.1.41455 WP_000271153.1.41466 WP_000271153.1.41478 WP_000271153.1.41488 WP_000271153.1.41530 WP_000271153.1.41536 WP_000271153.1.41545 WP_000271153.1.41556 WP_000271153.1.41566 WP_000271153.1.41613 WP_000271153.1.41621 WP_000271153.1.41651 WP_000271153.1.41654 WP_000271153.1.41712 WP_000271153.1.4172 WP_000271153.1.41734 WP_000271153.1.41780 WP_000271153.1.41782 WP_000271153.1.41812 WP_000271153.1.41813 WP_000271153.1.41849 WP_000271153.1.41900 WP_000271153.1.41988 WP_000271153.1.42022 WP_000271153.1.42036 WP_000271153.1.42038 WP_000271153.1.42060 WP_000271153.1.4213 WP_000271153.1.42138 WP_000271153.1.4214 WP_000271153.1.42179 WP_000271153.1.42203 WP_000271153.1.42209 WP_000271153.1.42226 WP_000271153.1.4224 WP_000271153.1.42252 WP_000271153.1.42367 WP_000271153.1.42376 WP_000271153.1.42387 WP_000271153.1.42415 WP_000271153.1.4242 WP_000271153.1.42442 WP_000271153.1.42447 WP_000271153.1.42480 WP_000271153.1.4250 WP_000271153.1.42513 WP_000271153.1.42522 WP_000271153.1.42594 WP_000271153.1.4261 WP_000271153.1.42661 WP_000271153.1.42748 WP_000271153.1.42749 WP_000271153.1.42771 WP_000271153.1.42832 WP_000271153.1.42863 WP_000271153.1.42879 WP_000271153.1.42918 WP_000271153.1.42936 WP_000271153.1.42937 WP_000271153.1.42950 WP_000271153.1.42975 WP_000271153.1.43013 WP_000271153.1.4306 WP_000271153.1.43079 WP_000271153.1.43121 WP_000271153.1.4313 WP_000271153.1.43140 WP_000271153.1.43166 WP_000271153.1.43196 WP_000271153.1.43239 WP_000271153.1.43270 WP_000271153.1.43316 WP_000271153.1.43384 WP_000271153.1.4342 WP_000271153.1.43448 WP_000271153.1.43455 WP_000271153.1.43469 WP_000271153.1.43474 WP_000271153.1.43489 WP_000271153.1.43536 WP_000271153.1.43604 WP_000271153.1.43642 WP_000271153.1.43720 WP_000271153.1.43750 WP_000271153.1.43754 WP_000271153.1.43769 WP_000271153.1.43798 WP_000271153.1.43804 WP_000271153.1.43816 WP_000271153.1.43837 WP_000271153.1.43858 WP_000271153.1.43898 WP_000271153.1.43911 WP_000271153.1.43918 WP_000271153.1.43939 WP_000271153.1.44018 WP_000271153.1.44020 WP_000271153.1.44075 WP_000271153.1.44077 WP_000271153.1.44096 WP_000271153.1.44115 WP_000271153.1.44125 WP_000271153.1.4415 WP_000271153.1.44162 WP_000271153.1.44165 WP_000271153.1.44166 WP_000271153.1.44203 WP_000271153.1.44238 WP_000271153.1.44273 WP_000271153.1.44285 WP_000271153.1.44292 WP_000271153.1.44365 WP_000271153.1.44389 WP_000271153.1.44445 WP_000271153.1.44488 WP_000271153.1.44524 WP_000271153.1.44561 WP_000271153.1.44587 WP_000271153.1.44608 WP_000271153.1.44724 WP_000271153.1.4473 WP_000271153.1.44733 WP_000271153.1.44756 WP_000271153.1.44849 WP_000271153.1.44854 WP_000271153.1.44857 WP_000271153.1.44906 WP_000271153.1.44954 WP_000271153.1.44961 WP_000271153.1.44970 WP_000271153.1.45020 WP_000271153.1.45028 WP_000271153.1.45076 WP_000271153.1.45104 WP_000271153.1.45153 WP_000271153.1.45195 WP_000271153.1.45208 WP_000271153.1.45293 WP_000271153.1.45301 WP_000271153.1.45329 WP_000271153.1.45404 WP_000271153.1.45575 WP_000271153.1.45595 WP_000271153.1.45600 WP_000271153.1.45664 WP_000271153.1.45707 WP_000271153.1.45718 WP_000271153.1.4574 WP_000271153.1.45741 WP_000271153.1.45840 WP_000271153.1.45841 WP_000271153.1.45846 WP_000271153.1.45865 WP_000271153.1.45868 WP_000271153.1.45901 WP_000271153.1.45930 WP_000271153.1.45933 WP_000271153.1.45941 WP_000271153.1.45960 WP_000271153.1.4600 WP_000271153.1.46027 WP_000271153.1.46039 WP_000271153.1.46049 WP_000271153.1.46081 WP_000271153.1.46105 WP_000271153.1.46115 WP_000271153.1.46122 WP_000271153.1.4613 WP_000271153.1.46186 WP_000271153.1.4619 WP_000271153.1.46239 WP_000271153.1.46282 WP_000271153.1.46283 WP_000271153.1.46369 WP_000271153.1.46414 WP_000271153.1.46433 WP_000271153.1.46451 WP_000271153.1.46503 WP_000271153.1.46526 WP_000271153.1.46555 WP_000271153.1.4657 WP_000271153.1.46582 WP_000271153.1.46597 WP_000271153.1.46611 WP_000271153.1.46626 WP_000271153.1.46668 WP_000271153.1.46802 WP_000271153.1.46810 WP_000271153.1.46832 WP_000271153.1.46882 WP_000271153.1.46913 WP_000271153.1.46990 WP_000271153.1.46999 WP_000271153.1.47028 WP_000271153.1.47034 WP_000271153.1.47038 WP_000271153.1.47048 WP_000271153.1.4708 WP_000271153.1.47140 WP_000271153.1.47197 WP_000271153.1.4723 WP_000271153.1.47246 WP_000271153.1.47280 WP_000271153.1.47307 WP_000271153.1.47319 WP_000271153.1.47332 WP_000271153.1.47356 WP_000271153.1.47363 WP_000271153.1.47370 WP_000271153.1.47398 WP_000271153.1.47401 WP_000271153.1.47411 WP_000271153.1.47414 WP_000271153.1.47425 WP_000271153.1.47473 WP_000271153.1.47477 WP_000271153.1.47634 WP_000271153.1.47662 WP_000271153.1.4772 WP_000271153.1.47744 WP_000271153.1.47761 WP_000271153.1.47784 WP_000271153.1.47790 WP_000271153.1.47820 WP_000271153.1.47827 WP_000271153.1.47848 WP_000271153.1.47884 WP_000271153.1.47954 WP_000271153.1.4796 WP_000271153.1.47962 WP_000271153.1.47976 WP_000271153.1.47994 WP_000271153.1.48000 WP_000271153.1.48018 WP_000271153.1.48065 WP_000271153.1.48073 WP_000271153.1.48077 WP_000271153.1.48111 WP_000271153.1.4812 WP_000271153.1.48144 WP_000271153.1.48176 WP_000271153.1.48194 WP_000271153.1.48222 WP_000271153.1.48226 WP_000271153.1.48258 WP_000271153.1.48290 WP_000271153.1.48291 WP_000271153.1.48421 WP_000271153.1.48433 WP_000271153.1.48483 WP_000271153.1.48505 WP_000271153.1.48571 WP_000271153.1.48615 WP_000271153.1.48697 WP_000271153.1.4871 WP_000271153.1.48712 WP_000271153.1.48792 WP_000271153.1.48801 WP_000271153.1.48806 WP_000271153.1.48860 WP_000271153.1.48910 WP_000271153.1.48921 WP_000271153.1.48953 WP_000271153.1.48954 WP_000271153.1.48974 WP_000271153.1.49009 WP_000271153.1.49107 WP_000271153.1.49147 WP_000271153.1.49190 WP_000271153.1.49229 WP_000271153.1.49243 WP_000271153.1.49275 WP_000271153.1.4931 WP_000271153.1.49332 WP_000271153.1.49336 WP_000271153.1.49363 WP_000271153.1.49401 WP_000271153.1.49459 WP_000271153.1.49464 WP_000271153.1.49481 WP_000271153.1.49482 WP_000271153.1.49496 WP_000271153.1.49531 WP_000271153.1.49537 WP_000271153.1.49546 WP_000271153.1.49558 WP_000271153.1.49567 WP_000271153.1.49599 WP_000271153.1.49645 WP_000271153.1.49655 WP_000271153.1.49661 WP_000271153.1.49712 WP_000271153.1.49733 WP_000271153.1.49747 WP_000271153.1.49771 WP_000271153.1.49856 WP_000271153.1.49861 WP_000271153.1.49900 WP_000271153.1.49950 WP_000271153.1.50006 WP_000271153.1.50008 WP_000271153.1.5003 WP_000271153.1.50036 WP_000271153.1.50078 WP_000271153.1.50110 WP_000271153.1.50113 WP_000271153.1.50119 WP_000271153.1.5017 WP_000271153.1.50182 WP_000271153.1.50191 WP_000271153.1.50207 WP_000271153.1.50258 WP_000271153.1.50269 WP_000271153.1.50278 WP_000271153.1.50345 WP_000271153.1.50353 WP_000271153.1.50358 WP_000271153.1.50361 WP_000271153.1.5037 WP_000271153.1.50380 WP_000271153.1.50412 WP_000271153.1.50452 WP_000271153.1.50549 WP_000271153.1.50616 WP_000271153.1.5064 WP_000271153.1.50715 WP_000271153.1.50725 WP_000271153.1.50762 WP_000271153.1.50969 WP_000271153.1.50986 WP_000271153.1.51013 WP_000271153.1.51027 WP_000271153.1.51042 WP_000271153.1.51154 WP_000271153.1.51171 WP_000271153.1.51172 WP_000271153.1.51175 WP_000271153.1.51260 WP_000271153.1.51278 WP_000271153.1.5128 WP_000271153.1.51283 WP_000271153.1.51299 WP_000271153.1.51405 WP_000271153.1.51427 WP_000271153.1.51462 WP_000271153.1.51505 WP_000271153.1.51525 WP_000271153.1.51537 WP_000271153.1.51539 WP_000271153.1.51552 WP_000271153.1.51580 WP_000271153.1.51629 WP_000271153.1.51643 WP_000271153.1.51693 WP_000271153.1.51707 WP_000271153.1.5172 WP_000271153.1.51784 WP_000271153.1.51834 WP_000271153.1.51839 WP_000271153.1.51985 WP_000271153.1.51988 WP_000271153.1.52020 WP_000271153.1.52039 WP_000271153.1.52076 WP_000271153.1.52127 WP_000271153.1.5217 WP_000271153.1.52186 WP_000271153.1.52200 WP_000271153.1.52211 WP_000271153.1.52214 WP_000271153.1.52243 WP_000271153.1.52249 WP_000271153.1.5227 WP_000271153.1.52272 WP_000271153.1.52305 WP_000271153.1.52378 WP_000271153.1.52492 WP_000271153.1.52496 WP_000271153.1.52543 WP_000271153.1.52558 WP_000271153.1.52710 WP_000271153.1.52735 WP_000271153.1.52774 WP_000271153.1.52777 WP_000271153.1.52780 WP_000271153.1.52801 WP_000271153.1.52853 WP_000271153.1.52881 WP_000271153.1.52883 WP_000271153.1.52895 WP_000271153.1.52908 WP_000271153.1.52913 WP_000271153.1.52933 WP_000271153.1.52945 WP_000271153.1.52962 WP_000271153.1.53012 WP_000271153.1.53020 WP_000271153.1.53065 WP_000271153.1.53084 WP_000271153.1.5310 WP_000271153.1.53155 WP_000271153.1.53181 WP_000271153.1.53211 WP_000271153.1.53223 WP_000271153.1.53238 WP_000271153.1.53242 WP_000271153.1.53251 WP_000271153.1.53252 WP_000271153.1.53270 WP_000271153.1.53356 WP_000271153.1.53364 WP_000271153.1.53377 WP_000271153.1.53401 WP_000271153.1.53428 WP_000271153.1.53505 WP_000271153.1.53537 WP_000271153.1.53545 WP_000271153.1.5362 WP_000271153.1.53642 WP_000271153.1.53645 WP_000271153.1.53809 WP_000271153.1.53810 WP_000271153.1.53866 WP_000271153.1.5393 WP_000271153.1.53931 WP_000271153.1.53966 WP_000271153.1.53972 WP_000271153.1.53978 WP_000271153.1.54002 WP_000271153.1.54013 WP_000271153.1.54024 WP_000271153.1.54072 WP_000271153.1.54091 WP_000271153.1.54169 WP_000271153.1.54185 WP_000271153.1.54202 WP_000271153.1.54213 WP_000271153.1.54307 WP_000271153.1.54317 WP_000271153.1.54359 WP_000271153.1.5441 WP_000271153.1.54454 WP_000271153.1.54507 WP_000271153.1.5460 WP_000271153.1.54602 WP_000271153.1.54605 WP_000271153.1.54617 WP_000271153.1.54620 WP_000271153.1.54638 WP_000271153.1.5467 WP_000271153.1.54688 WP_000271153.1.54695 WP_000271153.1.54708 WP_000271153.1.54725 WP_000271153.1.5479 WP_000271153.1.54829 WP_000271153.1.5486 WP_000271153.1.54883 WP_000271153.1.54927 WP_000271153.1.54941 WP_000271153.1.54981 WP_000271153.1.54991 WP_000271153.1.55041 WP_000271153.1.55144 WP_000271153.1.55197 WP_000271153.1.5520 WP_000271153.1.55218 WP_000271153.1.55286 WP_000271153.1.55357 WP_000271153.1.55359 WP_000271153.1.55374 WP_000271153.1.55381 WP_000271153.1.55489 WP_000271153.1.55492 WP_000271153.1.55529 WP_000271153.1.55551 WP_000271153.1.55552 WP_000271153.1.55556 WP_000271153.1.55560 WP_000271153.1.55597 WP_000271153.1.55608 WP_000271153.1.55629 WP_000271153.1.5570 WP_000271153.1.55709 WP_000271153.1.55730 WP_000271153.1.55820 WP_000271153.1.55825 WP_000271153.1.55838 WP_000271153.1.55844 WP_000271153.1.55868 WP_000271153.1.55892 WP_000271153.1.55897 WP_000271153.1.55988 WP_000271153.1.56072 WP_000271153.1.5614 WP_000271153.1.56151 WP_000271153.1.5616 WP_000271153.1.56164 WP_000271153.1.56177 WP_000271153.1.56193 WP_000271153.1.56216 WP_000271153.1.56231 WP_000271153.1.56302 WP_000271153.1.56371 WP_000271153.1.5639 WP_000271153.1.56390 WP_000271153.1.56392 WP_000271153.1.56399 WP_000271153.1.56439 WP_000271153.1.5646 WP_000271153.1.56481 WP_000271153.1.56489 WP_000271153.1.56491 WP_000271153.1.56513 WP_000271153.1.56528 WP_000271153.1.56543 WP_000271153.1.56554 WP_000271153.1.56571 WP_000271153.1.56680 WP_000271153.1.5670 WP_000271153.1.56704 WP_000271153.1.56721 WP_000271153.1.56799 WP_000271153.1.56830 WP_000271153.1.56835 WP_000271153.1.56871 WP_000271153.1.56934 WP_000271153.1.57032 WP_000271153.1.57051 WP_000271153.1.57068 WP_000271153.1.57071 WP_000271153.1.57072 WP_000271153.1.57086 WP_000271153.1.57124 WP_000271153.1.57180 WP_000271153.1.57181 WP_000271153.1.57197 WP_000271153.1.57222 WP_000271153.1.57280 WP_000271153.1.57281 WP_000271153.1.57386 WP_000271153.1.57410 WP_000271153.1.57414 WP_000271153.1.57432 WP_000271153.1.57453 WP_000271153.1.57466 WP_000271153.1.5748 WP_000271153.1.57487 WP_000271153.1.57517 WP_000271153.1.5755 WP_000271153.1.57558 WP_000271153.1.57610 WP_000271153.1.5764 WP_000271153.1.57646 WP_000271153.1.57659 WP_000271153.1.57738 WP_000271153.1.57812 WP_000271153.1.57836 WP_000271153.1.57846 WP_000271153.1.57920 WP_000271153.1.58001 WP_000271153.1.58022 WP_000271153.1.58045 WP_000271153.1.58048 WP_000271153.1.58057 WP_000271153.1.58080 WP_000271153.1.58146 WP_000271153.1.58163 WP_000271153.1.58169 WP_000271153.1.58172 WP_000271153.1.58206 WP_000271153.1.58232 WP_000271153.1.58238 WP_000271153.1.58244 WP_000271153.1.58289 WP_000271153.1.58316 WP_000271153.1.58340 WP_000271153.1.58371 WP_000271153.1.584 WP_000271153.1.58401 WP_000271153.1.5842 WP_000271153.1.58420 WP_000271153.1.58423 WP_000271153.1.58429 WP_000271153.1.58493 WP_000271153.1.58514 WP_000271153.1.5852 WP_000271153.1.58528 WP_000271153.1.58547 WP_000271153.1.58622 WP_000271153.1.58705 WP_000271153.1.58707 WP_000271153.1.58723 WP_000271153.1.58867 WP_000271153.1.58870 WP_000271153.1.58976 WP_000271153.1.58977 WP_000271153.1.58983 WP_000271153.1.59024 WP_000271153.1.59026 WP_000271153.1.59038 WP_000271153.1.59119 WP_000271153.1.59174 WP_000271153.1.59190 WP_000271153.1.59199 WP_000271153.1.59306 WP_000271153.1.59359 WP_000271153.1.59374 WP_000271153.1.59395 WP_000271153.1.59407 WP_000271153.1.59413 WP_000271153.1.59423 WP_000271153.1.59470 WP_000271153.1.59491 WP_000271153.1.59553 WP_000271153.1.59590 WP_000271153.1.59615 WP_000271153.1.59621 WP_000271153.1.59679 WP_000271153.1.59699 WP_000271153.1.59730 WP_000271153.1.59733 WP_000271153.1.59756 WP_000271153.1.59781 WP_000271153.1.59782 WP_000271153.1.59788 WP_000271153.1.59823 WP_000271153.1.59838 WP_000271153.1.59858 WP_000271153.1.59905 WP_000271153.1.59931 WP_000271153.1.59932 WP_000271153.1.59959 WP_000271153.1.59998 WP_000271153.1.6002 WP_000271153.1.60023 WP_000271153.1.60031 WP_000271153.1.60042 WP_000271153.1.60043 WP_000271153.1.60070 WP_000271153.1.60117 WP_000271153.1.6013 WP_000271153.1.6022 WP_000271153.1.60228 WP_000271153.1.60304 WP_000271153.1.60337 WP_000271153.1.60374 WP_000271153.1.60436 WP_000271153.1.60457 WP_000271153.1.60461 WP_000271153.1.60491 WP_000271153.1.60505 WP_000271153.1.60550 WP_000271153.1.60606 WP_000271153.1.6061 WP_000271153.1.60613 WP_000271153.1.60647 WP_000271153.1.6066 WP_000271153.1.60698 WP_000271153.1.60717 WP_000271153.1.60732 WP_000271153.1.60744 WP_000271153.1.60761 WP_000271153.1.60832 WP_000271153.1.60835 WP_000271153.1.60872 WP_000271153.1.60901 WP_000271153.1.60927 WP_000271153.1.60935 WP_000271153.1.61035 WP_000271153.1.61039 WP_000271153.1.61046 WP_000271153.1.61058 WP_000271153.1.61096 WP_000271153.1.61097 WP_000271153.1.61099 WP_000271153.1.6110 WP_000271153.1.61108 WP_000271153.1.61112 WP_000271153.1.61174 WP_000271153.1.61186 WP_000271153.1.61253 WP_000271153.1.61292 WP_000271153.1.61517 WP_000271153.1.61551 WP_000271153.1.61608 WP_000271153.1.61623 WP_000271153.1.61663 WP_000271153.1.61772 WP_000271153.1.618 WP_000271153.1.61806 WP_000271153.1.61874 WP_000271153.1.61939 WP_000271153.1.61948 WP_000271153.1.61949 WP_000271153.1.61957 WP_000271153.1.6212 WP_000271153.1.62135 WP_000271153.1.62182 WP_000271153.1.62264 WP_000271153.1.62290 WP_000271153.1.62296 WP_000271153.1.62337 WP_000271153.1.62358 WP_000271153.1.62460 WP_000271153.1.62480 WP_000271153.1.62503 WP_000271153.1.62514 WP_000271153.1.62529 WP_000271153.1.6261 WP_000271153.1.62612 WP_000271153.1.62646 WP_000271153.1.62675 WP_000271153.1.62735 WP_000271153.1.62769 WP_000271153.1.62787 WP_000271153.1.62812 WP_000271153.1.62818 WP_000271153.1.62843 WP_000271153.1.62851 WP_000271153.1.62888 WP_000271153.1.62919 WP_000271153.1.6293 WP_000271153.1.62973 WP_000271153.1.62989 WP_000271153.1.6299 WP_000271153.1.63078 WP_000271153.1.63113 WP_000271153.1.63167 WP_000271153.1.63189 WP_000271153.1.63287 WP_000271153.1.6331 WP_000271153.1.63330 WP_000271153.1.63374 WP_000271153.1.63393 WP_000271153.1.63437 WP_000271153.1.63445 WP_000271153.1.63453 WP_000271153.1.63466 WP_000271153.1.63467 WP_000271153.1.63470 WP_000271153.1.6348 WP_000271153.1.63484 WP_000271153.1.63487 WP_000271153.1.63491 WP_000271153.1.63536 WP_000271153.1.63563 WP_000271153.1.63586 WP_000271153.1.63615 WP_000271153.1.6364 WP_000271153.1.63666 WP_000271153.1.63703 WP_000271153.1.63746 WP_000271153.1.63810 WP_000271153.1.63872 WP_000271153.1.63957 WP_000271153.1.63964 WP_000271153.1.64008 WP_000271153.1.64014 WP_000271153.1.64040 WP_000271153.1.64050 WP_000271153.1.64074 WP_000271153.1.64086 WP_000271153.1.64150 WP_000271153.1.64161 WP_000271153.1.64175 WP_000271153.1.64193 WP_000271153.1.64285 WP_000271153.1.64286 WP_000271153.1.64321 WP_000271153.1.64337 WP_000271153.1.64371 WP_000271153.1.64448 WP_000271153.1.6445 WP_000271153.1.64458 WP_000271153.1.64519 WP_000271153.1.64528 WP_000271153.1.64621 WP_000271153.1.64693 WP_000271153.1.64695 WP_000271153.1.64707 WP_000271153.1.64746 WP_000271153.1.64789 WP_000271153.1.64881 WP_000271153.1.64912 WP_000271153.1.64946 WP_000271153.1.64990 WP_000271153.1.65035 WP_000271153.1.65084 WP_000271153.1.65097 WP_000271153.1.651 WP_000271153.1.65118 WP_000271153.1.65151 WP_000271153.1.65194 WP_000271153.1.65206 WP_000271153.1.65271 WP_000271153.1.65305 WP_000271153.1.65306 WP_000271153.1.65353 WP_000271153.1.6537 WP_000271153.1.65370 WP_000271153.1.65372 WP_000271153.1.65408 WP_000271153.1.65413 WP_000271153.1.65531 WP_000271153.1.65546 WP_000271153.1.65672 WP_000271153.1.65708 WP_000271153.1.6587 WP_000271153.1.65875 WP_000271153.1.65898 WP_000271153.1.65961 WP_000271153.1.65962 WP_000271153.1.65963 WP_000271153.1.65978 WP_000271153.1.65988 WP_000271153.1.6599 WP_000271153.1.65991 WP_000271153.1.66001 WP_000271153.1.66033 WP_000271153.1.6609 WP_000271153.1.66094 WP_000271153.1.66100 WP_000271153.1.66104 WP_000271153.1.66121 WP_000271153.1.66197 WP_000271153.1.66288 WP_000271153.1.6635 WP_000271153.1.66387 WP_000271153.1.66389 WP_000271153.1.66395 WP_000271153.1.66412 WP_000271153.1.66501 WP_000271153.1.66531 WP_000271153.1.6654 WP_000271153.1.66550 WP_000271153.1.66559 WP_000271153.1.66566 WP_000271153.1.66624 WP_000271153.1.66700 WP_000271153.1.66719 WP_000271153.1.66758 WP_000271153.1.66783 WP_000271153.1.66795 WP_000271153.1.66796 WP_000271153.1.66849 WP_000271153.1.66873 WP_000271153.1.66922 WP_000271153.1.66933 WP_000271153.1.67018 WP_000271153.1.67022 WP_000271153.1.67073 WP_000271153.1.67102 WP_000271153.1.67136 WP_000271153.1.67137 WP_000271153.1.67150 WP_000271153.1.67158 WP_000271153.1.67214 WP_000271153.1.6723 WP_000271153.1.6735 WP_000271153.1.67415 WP_000271153.1.67446 WP_000271153.1.67451 WP_000271153.1.67452 WP_000271153.1.67454 WP_000271153.1.67456 WP_000271153.1.67522 WP_000271153.1.67533 WP_000271153.1.67549 WP_000271153.1.67581 WP_000271153.1.67663 WP_000271153.1.67676 WP_000271153.1.6769 WP_000271153.1.67701 WP_000271153.1.67724 WP_000271153.1.67726 WP_000271153.1.67753 WP_000271153.1.67775 WP_000271153.1.67780 WP_000271153.1.678 WP_000271153.1.67853 WP_000271153.1.67992 WP_000271153.1.67999 WP_000271153.1.68008 WP_000271153.1.68011 WP_000271153.1.68012 WP_000271153.1.6802 WP_000271153.1.68025 WP_000271153.1.6803 WP_000271153.1.68039 WP_000271153.1.68079 WP_000271153.1.68096 WP_000271153.1.6814 WP_000271153.1.68170 WP_000271153.1.68175 WP_000271153.1.682 WP_000271153.1.68215 WP_000271153.1.68241 WP_000271153.1.68255 WP_000271153.1.68300 WP_000271153.1.68336 WP_000271153.1.68411 WP_000271153.1.68493 WP_000271153.1.68523 WP_000271153.1.68566 WP_000271153.1.68609 WP_000271153.1.68673 WP_000271153.1.68678 WP_000271153.1.68695 WP_000271153.1.68697 WP_000271153.1.68711 WP_000271153.1.68751 WP_000271153.1.68797 WP_000271153.1.6880 WP_000271153.1.6887 WP_000271153.1.68873 WP_000271153.1.68936 WP_000271153.1.69054 WP_000271153.1.69098 WP_000271153.1.6916 WP_000271153.1.69258 WP_000271153.1.69303 WP_000271153.1.69305 WP_000271153.1.69350 WP_000271153.1.69351 WP_000271153.1.694 WP_000271153.1.69472 WP_000271153.1.69473 WP_000271153.1.69551 WP_000271153.1.69593 WP_000271153.1.69646 WP_000271153.1.69655 WP_000271153.1.69689 WP_000271153.1.69780 WP_000271153.1.69803 WP_000271153.1.69810 WP_000271153.1.69818 WP_000271153.1.69887 WP_000271153.1.69896 WP_000271153.1.69972 WP_000271153.1.70063 WP_000271153.1.70123 WP_000271153.1.70125 WP_000271153.1.70149 WP_000271153.1.70200 WP_000271153.1.70213 WP_000271153.1.70357 WP_000271153.1.70407 WP_000271153.1.70414 WP_000271153.1.70477 WP_000271153.1.70492 WP_000271153.1.70517 WP_000271153.1.7052 WP_000271153.1.70539 WP_000271153.1.70576 WP_000271153.1.70582 WP_000271153.1.70592 WP_000271153.1.70694 WP_000271153.1.70705 WP_000271153.1.70713 WP_000271153.1.70723 WP_000271153.1.70745 WP_000271153.1.70787 WP_000271153.1.70794 WP_000271153.1.70801 WP_000271153.1.7090 WP_000271153.1.70900 WP_000271153.1.70952 WP_000271153.1.71003 WP_000271153.1.71024 WP_000271153.1.71042 WP_000271153.1.71099 WP_000271153.1.71109 WP_000271153.1.71113 WP_000271153.1.71134 WP_000271153.1.71147 WP_000271153.1.71159 WP_000271153.1.71162 WP_000271153.1.71192 WP_000271153.1.71199 WP_000271153.1.71205 WP_000271153.1.71225 WP_000271153.1.71226 WP_000271153.1.71269 WP_000271153.1.71275 WP_000271153.1.71323 WP_000271153.1.71327 WP_000271153.1.71339 WP_000271153.1.71409 WP_000271153.1.71423 WP_000271153.1.71448 WP_000271153.1.71522 WP_000271153.1.71540 WP_000271153.1.71603 WP_000271153.1.71680 WP_000271153.1.71695 WP_000271153.1.71712 WP_000271153.1.71757 WP_000271153.1.71837 WP_000271153.1.71840 WP_000271153.1.71874 WP_000271153.1.71938 WP_000271153.1.71940 WP_000271153.1.71944 WP_000271153.1.71975 WP_000271153.1.71993 WP_000271153.1.71995 WP_000271153.1.72013 WP_000271153.1.72016 WP_000271153.1.72053 WP_000271153.1.72090 WP_000271153.1.7210 WP_000271153.1.72125 WP_000271153.1.72141 WP_000271153.1.72153 WP_000271153.1.72157 WP_000271153.1.72180 WP_000271153.1.7225 WP_000271153.1.72261 WP_000271153.1.72270 WP_000271153.1.72322 WP_000271153.1.72397 WP_000271153.1.72427 WP_000271153.1.72485 WP_000271153.1.72493 WP_000271153.1.72521 WP_000271153.1.72522 WP_000271153.1.72535 WP_000271153.1.72537 WP_000271153.1.72606 WP_000271153.1.72614 WP_000271153.1.72619 WP_000271153.1.72641 WP_000271153.1.72643 WP_000271153.1.72663 WP_000271153.1.72694 WP_000271153.1.72695 WP_000271153.1.72747 WP_000271153.1.72751 WP_000271153.1.72758 WP_000271153.1.7277 WP_000271153.1.72858 WP_000271153.1.72860 WP_000271153.1.7291 WP_000271153.1.72910 WP_000271153.1.72913 WP_000271153.1.73010 WP_000271153.1.73032 WP_000271153.1.73072 WP_000271153.1.73075 WP_000271153.1.73085 WP_000271153.1.73126 WP_000271153.1.73129 WP_000271153.1.73197 WP_000271153.1.73217 WP_000271153.1.73230 WP_000271153.1.73239 WP_000271153.1.73249 WP_000271153.1.73257 WP_000271153.1.73259 WP_000271153.1.73295 WP_000271153.1.73326 WP_000271153.1.73340 WP_000271153.1.73343 WP_000271153.1.73385 WP_000271153.1.73428 WP_000271153.1.73430 WP_000271153.1.73468 WP_000271153.1.7349 WP_000271153.1.73626 WP_000271153.1.73663 WP_000271153.1.73700 WP_000271153.1.73709 WP_000271153.1.73717 WP_000271153.1.73743 WP_000271153.1.73785 WP_000271153.1.73797 WP_000271153.1.73801 WP_000271153.1.73827 WP_000271153.1.73835 WP_000271153.1.73859 WP_000271153.1.73882 WP_000271153.1.7392 WP_000271153.1.73934 WP_000271153.1.73942 WP_000271153.1.73968 WP_000271153.1.73992 WP_000271153.1.73995 WP_000271153.1.74123 WP_000271153.1.7413 WP_000271153.1.74156 WP_000271153.1.7424 WP_000271153.1.74251 WP_000271153.1.7429 WP_000271153.1.74309 WP_000271153.1.74365 WP_000271153.1.74431 WP_000271153.1.74444 WP_000271153.1.7446 WP_000271153.1.74478 WP_000271153.1.74491 WP_000271153.1.74501 WP_000271153.1.74521 WP_000271153.1.74528 WP_000271153.1.74532 WP_000271153.1.74536 WP_000271153.1.74557 WP_000271153.1.7461 WP_000271153.1.74624 WP_000271153.1.74625 WP_000271153.1.74652 WP_000271153.1.74689 WP_000271153.1.74691 WP_000271153.1.74720 WP_000271153.1.7475 WP_000271153.1.74752 WP_000271153.1.7478 WP_000271153.1.74811 WP_000271153.1.74828 WP_000271153.1.74844 WP_000271153.1.74852 WP_000271153.1.74854 WP_000271153.1.74885 WP_000271153.1.74895 WP_000271153.1.74904 WP_000271153.1.75030 WP_000271153.1.75050 WP_000271153.1.75112 WP_000271153.1.75136 WP_000271153.1.75181 WP_000271153.1.75243 WP_000271153.1.75248 WP_000271153.1.7536 WP_000271153.1.75382 WP_000271153.1.7539 WP_000271153.1.75435 WP_000271153.1.75465 WP_000271153.1.75491 WP_000271153.1.75507 WP_000271153.1.75536 WP_000271153.1.75537 WP_000271153.1.75577 WP_000271153.1.75588 WP_000271153.1.75594 WP_000271153.1.75629 WP_000271153.1.75644 WP_000271153.1.75676 WP_000271153.1.75679 WP_000271153.1.75694 WP_000271153.1.75696 WP_000271153.1.75758 WP_000271153.1.75767 WP_000271153.1.7583 WP_000271153.1.7597 WP_000271153.1.75973 WP_000271153.1.75989 WP_000271153.1.75995 WP_000271153.1.75999 WP_000271153.1.7603 WP_000271153.1.76036 WP_000271153.1.76054 WP_000271153.1.7608 WP_000271153.1.76103 WP_000271153.1.76129 WP_000271153.1.76152 WP_000271153.1.76189 WP_000271153.1.76196 WP_000271153.1.76305 WP_000271153.1.76312 WP_000271153.1.76384 WP_000271153.1.76390 WP_000271153.1.76407 WP_000271153.1.76446 WP_000271153.1.76448 WP_000271153.1.76462 WP_000271153.1.76477 WP_000271153.1.76542 WP_000271153.1.76595 WP_000271153.1.7661 WP_000271153.1.76619 WP_000271153.1.76697 WP_000271153.1.76815 WP_000271153.1.76827 WP_000271153.1.76918 WP_000271153.1.76948 WP_000271153.1.76965 WP_000271153.1.76966 WP_000271153.1.7699 WP_000271153.1.77015 WP_000271153.1.77022 WP_000271153.1.77070 WP_000271153.1.77099 WP_000271153.1.77109 WP_000271153.1.77128 WP_000271153.1.77173 WP_000271153.1.77214 WP_000271153.1.77239 WP_000271153.1.77258 WP_000271153.1.77275 WP_000271153.1.7728 WP_000271153.1.77284 WP_000271153.1.77326 WP_000271153.1.77341 WP_000271153.1.77392 WP_000271153.1.77452 WP_000271153.1.77495 WP_000271153.1.77503 WP_000271153.1.77551 WP_000271153.1.77595 WP_000271153.1.77608 WP_000271153.1.77636 WP_000271153.1.77644 WP_000271153.1.77648 WP_000271153.1.77707 WP_000271153.1.77760 WP_000271153.1.77767 WP_000271153.1.77768 WP_000271153.1.7781 WP_000271153.1.77826 WP_000271153.1.77833 WP_000271153.1.77949 WP_000271153.1.77961 WP_000271153.1.77979 WP_000271153.1.7799 WP_000271153.1.77999 WP_000271153.1.78000 WP_000271153.1.78063 WP_000271153.1.78089 WP_000271153.1.78099 WP_000271153.1.78101 WP_000271153.1.78102 WP_000271153.1.78188 WP_000271153.1.78196 WP_000271153.1.78297 WP_000271153.1.78321 WP_000271153.1.784 WP_000271153.1.7847 WP_000271153.1.7855 WP_000271153.1.78583 WP_000271153.1.78586 WP_000271153.1.78593 WP_000271153.1.78611 WP_000271153.1.78612 WP_000271153.1.78645 WP_000271153.1.78683 WP_000271153.1.78698 WP_000271153.1.78706 WP_000271153.1.78718 WP_000271153.1.78750 WP_000271153.1.78757 WP_000271153.1.78775 WP_000271153.1.7883 WP_000271153.1.78843 WP_000271153.1.78854 WP_000271153.1.78953 WP_000271153.1.78966 WP_000271153.1.79004 WP_000271153.1.79065 WP_000271153.1.79086 WP_000271153.1.79172 WP_000271153.1.79356 WP_000271153.1.7937 WP_000271153.1.7940 WP_000271153.1.79526 WP_000271153.1.79528 WP_000271153.1.79540 WP_000271153.1.79558 WP_000271153.1.79563 WP_000271153.1.79576 WP_000271153.1.79591 WP_000271153.1.79606 WP_000271153.1.79713 WP_000271153.1.79715 WP_000271153.1.79800 WP_000271153.1.79816 WP_000271153.1.79824 WP_000271153.1.79866 WP_000271153.1.7987 WP_000271153.1.79877 WP_000271153.1.7993 WP_000271153.1.79932 WP_000271153.1.79936 WP_000271153.1.79965 WP_000271153.1.79984 WP_000271153.1.80043 WP_000271153.1.80071 WP_000271153.1.80112 WP_000271153.1.80141 WP_000271153.1.80176 WP_000271153.1.80309 WP_000271153.1.80310 WP_000271153.1.80320 WP_000271153.1.80330 WP_000271153.1.80402 WP_000271153.1.80428 WP_000271153.1.80484 WP_000271153.1.80517 WP_000271153.1.80519 WP_000271153.1.8057 WP_000271153.1.80578 WP_000271153.1.80606 WP_000271153.1.80709 WP_000271153.1.80753 WP_000271153.1.80754 WP_000271153.1.80756 WP_000271153.1.80805 WP_000271153.1.80894 WP_000271153.1.8090 WP_000271153.1.80935 WP_000271153.1.80945 WP_000271153.1.80946 WP_000271153.1.80983 WP_000271153.1.810 WP_000271153.1.81034 WP_000271153.1.81054 WP_000271153.1.81070 WP_000271153.1.811 WP_000271153.1.81104 WP_000271153.1.81160 WP_000271153.1.81165 WP_000271153.1.81182 WP_000271153.1.8121 WP_000271153.1.81219 WP_000271153.1.81273 WP_000271153.1.8129 WP_000271153.1.81313 WP_000271153.1.81376 WP_000271153.1.81420 WP_000271153.1.81438 WP_000271153.1.81442 WP_000271153.1.81469 WP_000271153.1.81475 WP_000271153.1.81484 WP_000271153.1.81514 WP_000271153.1.81517 WP_000271153.1.81625 WP_000271153.1.81715 WP_000271153.1.81754 WP_000271153.1.81821 WP_000271153.1.81873 WP_000271153.1.81934 WP_000271153.1.81972 WP_000271153.1.81975 WP_000271153.1.82 WP_000271153.1.82010 WP_000271153.1.82057 WP_000271153.1.82059 WP_000271153.1.82062 WP_000271153.1.82074 WP_000271153.1.82137 WP_000271153.1.82217 WP_000271153.1.82240 WP_000271153.1.82242 WP_000271153.1.82296 WP_000271153.1.8235 WP_000271153.1.82378 WP_000271153.1.82439 WP_000271153.1.82572 WP_000271153.1.82594 WP_000271153.1.82629 WP_000271153.1.82661 WP_000271153.1.8268 WP_000271153.1.82682 WP_000271153.1.82700 WP_000271153.1.82711 WP_000271153.1.82715 WP_000271153.1.82754 WP_000271153.1.8277 WP_000271153.1.82797 WP_000271153.1.82799 WP_000271153.1.82820 WP_000271153.1.83020 WP_000271153.1.8306 WP_000271153.1.8308 WP_000271153.1.83099 WP_000271153.1.831 WP_000271153.1.83151 WP_000271153.1.83205 WP_000271153.1.83224 WP_000271153.1.83712 WP_000271153.1.83735 WP_000271153.1.83762 WP_000271153.1.83820 WP_000271153.1.83947 WP_000271153.1.8411 WP_000271153.1.84140 WP_000271153.1.84172 WP_000271153.1.84185 WP_000271153.1.84219 WP_000271153.1.84264 WP_000271153.1.84312 WP_000271153.1.84313 WP_000271153.1.84331 WP_000271153.1.84405 WP_000271153.1.84436 WP_000271153.1.8444 WP_000271153.1.84473 WP_000271153.1.84482 WP_000271153.1.84484 WP_000271153.1.84534 WP_000271153.1.84584 WP_000271153.1.84635 WP_000271153.1.84656 WP_000271153.1.84657 WP_000271153.1.8470 WP_000271153.1.84740 WP_000271153.1.8477 WP_000271153.1.84797 WP_000271153.1.84841 WP_000271153.1.84850 WP_000271153.1.84881 WP_000271153.1.84893 WP_000271153.1.84894 WP_000271153.1.84929 WP_000271153.1.84941 WP_000271153.1.84948 WP_000271153.1.84989 WP_000271153.1.84994 WP_000271153.1.85002 WP_000271153.1.85011 WP_000271153.1.85112 WP_000271153.1.85155 WP_000271153.1.8517 WP_000271153.1.85175 WP_000271153.1.85253 WP_000271153.1.85255 WP_000271153.1.85310 WP_000271153.1.85335 WP_000271153.1.85336 WP_000271153.1.85342 WP_000271153.1.85435 WP_000271153.1.85558 WP_000271153.1.85657 WP_000271153.1.85722 WP_000271153.1.85772 WP_000271153.1.8579 WP_000271153.1.85939 WP_000271153.1.85944 WP_000271153.1.85948 WP_000271153.1.86035 WP_000271153.1.8607 WP_000271153.1.86105 WP_000271153.1.86115 WP_000271153.1.86149 WP_000271153.1.86161 WP_000271153.1.86171 WP_000271153.1.86181 WP_000271153.1.86225 WP_000271153.1.86255 WP_000271153.1.86263 WP_000271153.1.86266 WP_000271153.1.86283 WP_000271153.1.86294 WP_000271153.1.86307 WP_000271153.1.86340 WP_000271153.1.86355 WP_000271153.1.86371 WP_000271153.1.86412 WP_000271153.1.86451 WP_000271153.1.86454 WP_000271153.1.86461 WP_000271153.1.86475 WP_000271153.1.86492 WP_000271153.1.8652 WP_000271153.1.86574 WP_000271153.1.86583 WP_000271153.1.86598 WP_000271153.1.86609 WP_000271153.1.86617 WP_000271153.1.86640 WP_000271153.1.86674 WP_000271153.1.86691 WP_000271153.1.86731 WP_000271153.1.86833 WP_000271153.1.8687 WP_000271153.1.86956 WP_000271153.1.86959 WP_000271153.1.86994 WP_000271153.1.86997 WP_000271153.1.87075 WP_000271153.1.87076 WP_000271153.1.87109 WP_000271153.1.87189 WP_000271153.1.87247 WP_000271153.1.87249 WP_000271153.1.87254 WP_000271153.1.87310 WP_000271153.1.87382 WP_000271153.1.87389 WP_000271153.1.87465 WP_000271153.1.87568 WP_000271153.1.87616 WP_000271153.1.87639 WP_000271153.1.87655 WP_000271153.1.87694 WP_000271153.1.87721 WP_000271153.1.87726 WP_000271153.1.87728 WP_000271153.1.87788 WP_000271153.1.87789 WP_000271153.1.87834 WP_000271153.1.87980 WP_000271153.1.87989 WP_000271153.1.88017 WP_000271153.1.88020 WP_000271153.1.88088 WP_000271153.1.88110 WP_000271153.1.88149 WP_000271153.1.88155 WP_000271153.1.88197 WP_000271153.1.88252 WP_000271153.1.88304 WP_000271153.1.88376 WP_000271153.1.88384 WP_000271153.1.8843 WP_000271153.1.88434 WP_000271153.1.88462 WP_000271153.1.88524 WP_000271153.1.88528 WP_000271153.1.88535 WP_000271153.1.88539 WP_000271153.1.88598 WP_000271153.1.88603 WP_000271153.1.88607 WP_000271153.1.88631 WP_000271153.1.88646 WP_000271153.1.8873 WP_000271153.1.88732 WP_000271153.1.88759 WP_000271153.1.8879 WP_000271153.1.88803 WP_000271153.1.88834 WP_000271153.1.88883 WP_000271153.1.88891 WP_000271153.1.89050 WP_000271153.1.8906 WP_000271153.1.89067 WP_000271153.1.89099 WP_000271153.1.89183 WP_000271153.1.89197 WP_000271153.1.89200 WP_000271153.1.89255 WP_000271153.1.89305 WP_000271153.1.89322 WP_000271153.1.89335 WP_000271153.1.8938 WP_000271153.1.89385 WP_000271153.1.894 WP_000271153.1.89405 WP_000271153.1.89416 WP_000271153.1.89458 WP_000271153.1.89468 WP_000271153.1.89474 WP_000271153.1.89479 WP_000271153.1.89492 WP_000271153.1.89569 WP_000271153.1.89601 WP_000271153.1.89646 WP_000271153.1.89700 WP_000271153.1.89768 WP_000271153.1.89781 WP_000271153.1.89788 WP_000271153.1.89818 WP_000271153.1.89839 WP_000271153.1.89852 WP_000271153.1.89895 WP_000271153.1.89915 WP_000271153.1.89920 WP_000271153.1.89959 WP_000271153.1.89988 WP_000271153.1.90017 WP_000271153.1.90063 WP_000271153.1.90078 WP_000271153.1.9010 WP_000271153.1.90139 WP_000271153.1.90146 WP_000271153.1.90156 WP_000271153.1.90205 WP_000271153.1.90219 WP_000271153.1.90257 WP_000271153.1.90342 WP_000271153.1.90349 WP_000271153.1.90358 WP_000271153.1.9036 WP_000271153.1.90405 WP_000271153.1.90435 WP_000271153.1.90441 WP_000271153.1.90511 WP_000271153.1.90536 WP_000271153.1.90547 WP_000271153.1.90591 WP_000271153.1.9061 WP_000271153.1.90690 WP_000271153.1.90813 WP_000271153.1.90822 WP_000271153.1.90837 WP_000271153.1.90848 WP_000271153.1.90856 WP_000271153.1.90890 WP_000271153.1.90951 WP_000271153.1.90967 WP_000271153.1.90979 WP_000271153.1.9098 WP_000271153.1.90997 WP_000271153.1.91072 WP_000271153.1.91088 WP_000271153.1.91094 WP_000271153.1.91113 WP_000271153.1.91153 WP_000271153.1.91170 WP_000271153.1.91266 WP_000271153.1.91277 WP_000271153.1.91288 WP_000271153.1.91340 WP_000271153.1.91341 WP_000271153.1.91356 WP_000271153.1.91384 WP_000271153.1.91462 WP_000271153.1.91485 WP_000271153.1.91511 WP_000271153.1.91548 WP_000271153.1.91551 WP_000271153.1.9157 WP_000271153.1.91596 WP_000271153.1.9160 WP_000271153.1.91643 WP_000271153.1.91644 WP_000271153.1.91651 WP_000271153.1.91672 WP_000271153.1.9168 WP_000271153.1.9169 WP_000271153.1.91777 WP_000271153.1.91787 WP_000271153.1.91801 WP_000271153.1.91871 WP_000271153.1.91879 WP_000271153.1.91951 WP_000271153.1.91965 WP_000271153.1.91971 WP_000271153.1.92014 WP_000271153.1.921 WP_000271153.1.92102 WP_000271153.1.92114 WP_000271153.1.92161 WP_000271153.1.92163 WP_000271153.1.92215 WP_000271153.1.92311 WP_000271153.1.92434 WP_000271153.1.92496 WP_000271153.1.9255 WP_000271153.1.92568 WP_000271153.1.92577 WP_000271153.1.92615 WP_000271153.1.9266 WP_000271153.1.92668 WP_000271153.1.92693 WP_000271153.1.92719 WP_000271153.1.92742 WP_000271153.1.92780 WP_000271153.1.92781 WP_000271153.1.92819 WP_000271153.1.92845 WP_000271153.1.92943 WP_000271153.1.92953 WP_000271153.1.93016 WP_000271153.1.93019 WP_000271153.1.93027 WP_000271153.1.93033 WP_000271153.1.93054 WP_000271153.1.93069 WP_000271153.1.93112 WP_000271153.1.93252 WP_000271153.1.9327 WP_000271153.1.93276 WP_000271153.1.93312 WP_000271153.1.93338 WP_000271153.1.93379 WP_000271153.1.93388 WP_000271153.1.93427 WP_000271153.1.93428 WP_000271153.1.93509 WP_000271153.1.93531 WP_000271153.1.93569 WP_000271153.1.93601 WP_000271153.1.93630 WP_000271153.1.93637 WP_000271153.1.93652 WP_000271153.1.93665 WP_000271153.1.93670 WP_000271153.1.93695 WP_000271153.1.93733 WP_000271153.1.93755 WP_000271153.1.93768 WP_000271153.1.93821 WP_000271153.1.93873 WP_000271153.1.94008 WP_000271153.1.94011 WP_000271153.1.94156 WP_000271153.1.9416 WP_000271153.1.94176 WP_000271153.1.94213 WP_000271153.1.9426 WP_000271153.1.94271 WP_000271153.1.94298 WP_000271153.1.94302 WP_000271153.1.94343 WP_000271153.1.94353 WP_000271153.1.94388 WP_000271153.1.94468 WP_000271153.1.94475 WP_000271153.1.94507 WP_000271153.1.94544 WP_000271153.1.94548 WP_000271153.1.9457 WP_000271153.1.94578 WP_000271153.1.94580 WP_000271153.1.94589 WP_000271153.1.94646 WP_000271153.1.94676 WP_000271153.1.94738 WP_000271153.1.94754 WP_000271153.1.94790 WP_000271153.1.948 WP_000271153.1.94822 WP_000271153.1.94836 WP_000271153.1.94880 WP_000271153.1.94889 WP_000271153.1.9489 WP_000271153.1.94903 WP_000271153.1.94935 WP_000271153.1.94938 WP_000271153.1.94949 WP_000271153.1.94991 WP_000271153.1.94993 WP_000271153.1.95005 WP_000271153.1.95011 WP_000271153.1.95022 WP_000271153.1.95028 WP_000271153.1.95035 WP_000271153.1.95062 WP_000271153.1.95129 WP_000271153.1.9513 WP_000271153.1.95275 WP_000271153.1.95332 WP_000271153.1.95368 WP_000271153.1.95390 WP_000271153.1.95400 WP_000271153.1.95424 WP_000271153.1.95438 WP_000271153.1.95490 WP_000271153.1.95563 WP_000271153.1.9559 WP_000271153.1.95595 WP_000271153.1.95604 WP_000271153.1.95611 WP_000271153.1.95655 WP_000271153.1.95827 WP_000271153.1.95834 WP_000271153.1.95849 WP_000271153.1.95916 WP_000271153.1.96086 WP_000271153.1.96114 WP_000271153.1.9616 WP_000271153.1.96177 WP_000271153.1.96215 WP_000271153.1.96229 WP_000271153.1.96247 WP_000271153.1.96299 WP_000271153.1.96303 WP_000271153.1.96339 WP_000271153.1.96394 WP_000271153.1.96425 WP_000271153.1.96450 WP_000271153.1.96457 WP_000271153.1.96480 WP_000271153.1.96494 WP_000271153.1.96562 WP_000271153.1.96585 WP_000271153.1.96609 WP_000271153.1.96725 WP_000271153.1.96796 WP_000271153.1.9690 WP_000271153.1.96924 WP_000271153.1.96936 WP_000271153.1.97027 WP_000271153.1.97193 WP_000271153.1.97231 WP_000271153.1.97238 WP_000271153.1.97247 WP_000271153.1.9729 WP_000271153.1.97344 WP_000271153.1.97351 WP_000271153.1.97356 WP_000271153.1.97360 WP_000271153.1.97361 WP_000271153.1.9740 WP_000271153.1.97402 WP_000271153.1.97418 WP_000271153.1.97421 WP_000271153.1.97434 WP_000271153.1.97459 WP_000271153.1.97513 WP_000271153.1.97538 WP_000271153.1.97544 WP_000271153.1.97632 WP_000271153.1.97685 WP_000271153.1.9770 WP_000271153.1.97705 WP_000271153.1.97789 WP_000271153.1.978 WP_000271153.1.97822 WP_000271153.1.97871 WP_000271153.1.97932 WP_000271153.1.97937 WP_000271153.1.97962 WP_000271153.1.97982 WP_000271153.1.98026 WP_000271153.1.98046 WP_000271153.1.98082 WP_000271153.1.98083 WP_000271153.1.981 WP_000271153.1.98139 WP_000271153.1.98155 WP_000271153.1.9816 WP_000271153.1.9817 WP_000271153.1.98176 WP_000271153.1.98187 WP_000271153.1.98202 WP_000271153.1.98205 WP_000271153.1.98232 WP_000271153.1.98235 WP_000271153.1.98279 WP_000271153.1.98292 WP_000271153.1.98294 WP_000271153.1.98301 WP_000271153.1.98312 WP_000271153.1.98355 WP_000271153.1.98357 WP_000271153.1.98384 WP_000271153.1.98400 WP_000271153.1.98404 WP_000271153.1.98424 WP_000271153.1.98543 WP_000271153.1.98549 WP_000271153.1.98569 WP_000271153.1.9858 WP_000271153.1.98628 WP_000271153.1.98702 WP_000271153.1.98776 WP_000271153.1.98795 WP_000271153.1.9883 WP_000271153.1.98875 WP_000271153.1.98920 WP_000271153.1.98988 WP_000271153.1.99029 WP_000271153.1.99101 WP_000271153.1.99182 WP_000271153.1.99234 WP_000271153.1.99246 WP_000271153.1.99292 WP_000271153.1.99295 WP_000271153.1.99302 WP_000271153.1.99334 WP_000271153.1.99345 WP_000271153.1.99361 WP_000271153.1.99366 WP_000271153.1.99392 WP_000271153.1.99446 WP_000271153.1.99453 WP_000271153.1.99487 WP_000271153.1.99501 WP_000271153.1.99562 WP_000271153.1.99602 WP_000271153.1.99603 WP_000271153.1.99666 WP_000271153.1.99692 WP_000271153.1.99827 WP_000271153.1.99869 WP_000271153.1.99986 155864.Z0824 316385.ECDH10B_0742 316407.nagA 331111.EcE24377A_0702 386585.ECs0707 444450.ECH74115_0768 511145.b0677 544404.ECSP_0724 573235.ECO26_0741 585395.ECO103_0673 585396.ECO111_0696 595496.BWG_0537 gi|170080346|ref|YP_001729666.1| gi|387505726|ref|YP_006157982.1| 1yrrA 1ymy_A 1ymy_B 1yrr_A 1yrr_B 2p50_A 2p50_B 2p50_C 2p50_D gi|254791829|ref|YP_003076666.1| gi|544389457|ref|YP_008563856.1| gi|387881243|ref|YP_006311545.1| gi|386703848|ref|YP_006167695.1| gi|291281615|ref|YP_003498433.1| gi|209396073|ref|YP_002269303.1| gi|15829961|ref|NP_308734.1| gi|471332745|ref|YP_007556222.1| gi|378713955|ref|YP_005278848.1| gi|386708448|ref|YP_006172169.1| gi|443616704|ref|YP_007380560.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]