SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ysxA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ysxA
Domain Number 1 Region: 5-192
Classification Level Classification E-value
Superfamily Serum albumin-like 3.12e-75
Family Serum albumin-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ysxA   PDB: 1ysx
Sequence length 201
Comment (A:)
Sequence
qnlikqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeak
rmpcaedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefna
etftfhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddk
etcfaeegkklvaasqaalgl
Download sequence
Identical sequences 1ysxA 1ysx_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]