SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ytlA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ytlA
Domain Number 1 Region: 19-172
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.53e-52
Family ACDE2-like 0.000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ytlA   PDB: 1ytl
Sequence length 174
Comment (A:)
Sequence
akaleqpfdvanipgpkmatllekgkpvanmikkakrpllivgpdmtdemfervkkfvek
ditvvatgsaitrfidaglgekvnyavlheltqflldpdwkgfdgqgnydlvlmlgsiyy
hgsqmlaaiknfaphiralaidryyhpnadmsfgnlwkkeedylklldeilael
Download sequence
Identical sequences 1ytlA 1ytl_A 1ytl_B 1ytl_C 1ytl_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]